KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0109
Entry
APL_0109          CDS       T00476                                 
Name
(GenBank) hypothetical protein
  KO
K01934  5-formyltetrahydrofolate cyclo-ligase [EC:6.3.3.2]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
apl00670  One carbon pool by folate
apl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    APL_0109
Enzymes [BR:apl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.2  5-formyltetrahydrofolate cyclo-ligase
     APL_0109
SSDB
Motif
Pfam: 5-FTHF_cyc-lig DUF6015
Other DBs
NCBI-ProteinID: ABN73217
UniProt: A3MYI1
Position
complement(128145..128720)
AA seq 191 aa
MQSHSVQTRRQLRQSILNERAKLALEQQSIASFNLIPQALALINQYHTEHIALYLPFNSE
ISPLPLIERLQQQNKSLYLPILHPFAKGHLFFQQYDAETLFITHKFGMQQPKPDVRKVKP
LNEIEMIFTPLLACDKSGNRLGYGGGFYDRTLALTPQAISVGLAYPFQFVENLPTEPWDI
PLNHLIIGDIK
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcaatcacattccgtacaaactcgcagacaacttcgtcaatccattctgaacgaacga
gctaaattagctttagaacaacaatcaatcgcttcttttaatctgattccgcaagcactt
gctcttatcaatcaatatcacaccgaacatattgcactctatttgccttttaatagcgaa
atttcaccgcttccgttgattgaacgattacaacaacaaaacaaatcgctctatctgcct
attctccatccgtttgctaaaggtcatctgttctttcaacaatatgatgcagaaacgcta
ttcatcacgcataaattcggtatgcaacagcctaagccggacgtacgtaaggtaaaaccg
ttaaatgaaatcgagatgatatttactccgctacttgcttgtgataaaagcggtaatcgt
ttaggttacggaggcggtttttatgacagaacgcttgccctaactccgcaagcgataagc
gtagggcttgcatatccgtttcaatttgttgagaatttaccgacggaaccttgggatata
ccgcttaaccacttgatcataggagatataaagtga

DBGET integrated database retrieval system