KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0115
Entry
APL_0115          CDS       T00476                                 
Symbol
thyA
Name
(GenBank) thymidylate synthase
  KO
K00560  thymidylate synthase [EC:2.1.1.45]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
apl00240  Pyrimidine metabolism
apl00670  One carbon pool by folate
apl01100  Metabolic pathways
apl01232  Nucleotide metabolism
Module
apl_M00938  Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP
Brite
KEGG Orthology (KO) [BR:apl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    APL_0115 (thyA)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    APL_0115 (thyA)
Enzymes [BR:apl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     APL_0115 (thyA)
SSDB
Motif
Pfam: Thymidylat_synt
Other DBs
NCBI-ProteinID: ABN73223
UniProt: A3MYI7
Position
complement(132285..133136)
AA seq 283 aa
MKQYLDLCHRIVNEGKWVENERTGKRCLTVINADLTYNVATGEFPLVTTRRSFWKAAIAE
LLGYIRGYDNAADFRKLGTKSWDANANQNLAWLANPYRKGEDDMGLVYGAVGRNFPKADG
GSVDLLRQIVDDLKKGVDNRGEIYTFYHPGVFHMGCLRPCLYSHHFSLLDGTLYLNSTQR
SADVPLGLNWNMIQCYTFLALMAQITGHKAGQAFHKIVNAHIYEDQLELMRDVQLKRKPL
ASPKLWINPAIKSLEDLETWVTLDDFKVEGYEYHPAIQYPFSV
NT seq 852 nt   +upstreamnt  +downstreamnt
atgaaacagtatttagatttatgccatcgtatcgtaaacgaaggaaaatgggtagagaac
gaacgtactggtaagcgttgtttaaccgtaattaatgccgatttaacctacaatgttgca
accggagagtttccgcttgttacaacaagaagaagtttttggaaagcggcgattgcggaa
ttattgggttatattcgaggctatgataatgccgccgatttccgcaaactgggaacaaaa
tcatgggatgccaatgcaaatcaaaacttggcttggttagccaatccgtatcgtaaaggc
gaagatgatatgggtttggtttacggcgcggtcggacgtaacttcccgaaagcggacgga
ggttccgtcgatttattgcgccagattgtcgatgatttaaaaaagggagtggataatcgc
ggcgaaatttataccttttatcatccgggcgtattccatatgggctgtttacgtccctgc
ttatatagccatcatttctcgcttttagacggcacgctttatttaaacagtacgcaacgt
tccgccgatgtaccgcttgggctcaattggaatatgatccaatgctataccttcttggct
ttaatggcgcaaattaccggacataaagccggacaagcgtttcataaaatcgtaaatgcg
catatttatgaagaccaattggaattgatgcgtgacgtacaattgaaaagaaagccgctg
gcttctcctaaactttggattaatccggcaattaaatcattagaggatttagaaacttgg
gtaacgctcgatgattttaaagtcgaaggttacgaatatcatccggcaatccaatatccg
ttctcggtataa

DBGET integrated database retrieval system