KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0211
Entry
APL_0211          CDS       T00476                                 
Symbol
glyA
Name
(GenBank) glycine/serine hydroxymethyltransferase
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
apl00260  Glycine, serine and threonine metabolism
apl00460  Cyanoamino acid metabolism
apl00630  Glyoxylate and dicarboxylate metabolism
apl00670  One carbon pool by folate
apl00680  Methane metabolism
apl01100  Metabolic pathways
apl01110  Biosynthesis of secondary metabolites
apl01120  Microbial metabolism in diverse environments
apl01200  Carbon metabolism
apl01230  Biosynthesis of amino acids
apl01240  Biosynthesis of cofactors
Module
apl_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:apl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    APL_0211 (glyA)
  09102 Energy metabolism
   00680 Methane metabolism
    APL_0211 (glyA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    APL_0211 (glyA)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    APL_0211 (glyA)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    APL_0211 (glyA)
Enzymes [BR:apl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     APL_0211 (glyA)
SSDB
Motif
Pfam: SHMT Aminotran_1_2 Beta_elim_lyase
Other DBs
NCBI-ProteinID: ABN73319
UniProt: A3MYT3
Position
complement(228822..230087)
AA seq 421 aa
MFTANMNIQDYDPILWQAIENENRRQEEHIELIASENYASPRVMQAQGSQFTNKYAEGYP
GKRYYGGCEYADIVEQLAIDRAKQLFGADYVNVQPHSGSQANAAVYGALIQPNDTILGMD
LAHGGHLTHGAKVSFSGKIYNSVLYGITAEGLIDYEDVRQKALECKPKMIVAGFSAYSQI
VDWAKMREIADEVGAYLFVDMAHVAGLIAAGVYPSPLPYAHVVTTTTHKTLGGPRGGLIL
SACGDEEIYKKLQSSVFPANQGGPLVHIIAAKAVCFKEALEPEYKIYQQNVVKNAKAMVE
VFKQRSYEVISNGTENHLFLVSFVKQGLTGKAADAALGQANITVNKNSVPNDPQKPFITS
GIRIGTPAVTRRGFKEADVQALAGWMCDVLDSIGKDNHEQVIAETKAKVLDICARLPVYA
K
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgtttacagcaaatatgaacattcaagattacgaccctattttatggcaggcgattgaa
aacgaaaatcgccgtcaagaagaacatattgagctgattgcttcggaaaactatgcaagc
cctcgagtgatgcaggcgcaaggttcgcaatttactaataaatatgccgaaggttatccg
ggaaaacgctattacggcggttgcgaatatgcggatattgtcgagcaattagcgattgat
cgtgcgaaacagttattcggtgcagactatgtaaacgtccaaccgcattcaggctcacaa
gcgaatgcagctgtttacggcgcattaattcaaccgaacgataccattttaggtatggac
ttagcacatggaggccatttaacgcacggagcaaaagtgagcttctcaggcaaaatttat
aattctgtcctctacggcatcacagccgaaggcttaattgattatgaagacgtccgtcaa
aaagcgcttgagtgtaagccaaaaatgattgttgccggcttttccgcttattcacaaatc
gtagattgggcgaaaatgcgtgaaattgccgatgaagtcggtgcttatttattcgtcgat
atggcgcacgttgccggtttaattgcggcaggcgtttacccaagcccgcttccttacgct
cacgttgttacaaccacaacccataaaactttaggcggtccgcgcggcggtttaattctt
tccgcttgtggcgatgaagaaatttataaaaaactgcaatcttcggttttcccggcaaac
caaggagggccattagtgcatattattgcggcgaaagcggtttgctttaaagaagcgctt
gagcctgaatataaaatctatcaacaaaatgtagttaaaaatgcgaaagcaatggtagaa
gtattcaaacaacgcagctatgaagtaatttcaaacggtaccgaaaaccacttattctta
gtcagctttgtaaaacaaggcttaaccggtaaagcggcagatgcggcgttaggtcaagcg
aatatcaccgtaaataaaaattccgtgccgaatgatccgcaaaaaccgtttattacttcc
ggtattcgcatcggtacgcctgccgttactcgtcgcggtttcaaagaagcggacgttcaa
gcccttgccggctggatgtgcgacgtattggacagcatcggtaaagacaatcacgaacaa
gtaattgcggaaaccaaagcgaaagtgcttgatatttgcgctcgcttgccggtatatgcc
aaataa

DBGET integrated database retrieval system