KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0466
Entry
APL_0466          CDS       T00476                                 
Symbol
fhs
Name
(GenBank) formyltetrahydrofolate synthetase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
apl00670  One carbon pool by folate
apl01100  Metabolic pathways
apl01120  Microbial metabolism in diverse environments
apl01200  Carbon metabolism
apl01240  Biosynthesis of cofactors
Module
apl_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:apl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    APL_0466 (fhs)
Enzymes [BR:apl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     APL_0466 (fhs)
SSDB
Motif
Pfam: FTHFS NB-ARC CbiA
Other DBs
NCBI-ProteinID: ABN73570
UniProt: A3MZI4
Position
complement(537209..538879)
AA seq 556 aa
MKSDVEIAQAATMQPIHKIAEKLGLNADQIEQYGKYKAKINPTDAFKLPAKNGKLILVTA
INPTPAGEGKTTVTIGLTDALNQLGKNAVVAAREPSLGPVFGVKGGAAGGGYAQVLPMED
INLHFTGDFHAITSANNLLAALLDNHIYQGNALNIDTKRVLWRRVIDMNDRQLRNVLGGL
GNPTDGVIRPDGFDITVASEVMAIFCLAKDLADLKTRLGNILVAYTKDKQPVYAKDLNAH
GAMAALLKDAIKPNLVQTIEGSPAFIHGGPFANIAHGCNSVTATRLALHLGDYAVTEAGF
GADLGAEKFCDIKCRLADLKPDVAVVVATVKALKYNGGVEKANLAEENLTALQQGLPNLL
KHISNLKNVFGLPVVVALNRFVSDTDAELALIQTACAKQGVEVSLTEVWGKGGAGGVDLA
QKVLKAIDEQENRFNFVYDVNESVQNKIKAIAQKIYGADDVNFSAEALAEIKNLEKLGLD
KLPICMAKTQYSLSDNAKLLGCPSGFTVTVRSISVSAGAGFIVAICGSIMRMPGLPKVPA
ANRIDVDENGLITGLF
NT seq 1671 nt   +upstreamnt  +downstreamnt
atgaaaagcgatgtagaaattgctcaggcggcgactatgcagccgattcacaaaattgct
gaaaagctaggtttaaatgccgatcaaattgaacaatacggcaaatataaagcaaaaatt
aaccctacagatgcgtttaaattaccggctaaaaacggtaaattaattttagtgactgcg
attaacccgacgccggcaggcgaaggcaaaacgaccgtcactatcggtttaaccgatgcg
ttaaatcaacttggtaaaaatgctgtggttgcggcacgtgagccgtcgttaggtccggta
ttcggcgtgaaaggcggtgcggccggcggcggttatgcacaagtattgccaatggaagat
atcaacctacactttaccggcgatttccacgccattaccagtgccaataacctcttagca
gcgttattggataaccatatctaccaaggcaatgcgttaaatattgataccaaacgtgtg
ttatggcgacgtgttattgatatgaatgatcgtcaattacgtaacgtattgggggggtta
ggcaatccgaccgatggcgtgattcgtccggacggtttcgatattaccgtagcttcagaa
gtgatggcaattttctgtttagcgaaagatcttgctgatttaaaaacgcgtttaggtaat
atcttagtcgcttacactaaagataaacagccggtttatgcgaaagatttaaatgcgcat
ggggcaatggcggcattattaaaagatgcgattaaaccgaatttagtacaaacgattgaa
ggcagccctgcctttattcacggtggcccgtttgccaatatcgctcacggttgtaactcg
gttaccgcaacacgtttagcattacatttaggtgattatgcagtaacagaagccggtttc
ggtgcggacttaggtgcagaaaaattctgtgatattaaatgccgtttagctgatcttaaa
ccggatgtagctgtggtcgttgccacggtaaaagcgctgaaatataacggcggtgttgaa
aaagcgaatttagctgaagaaaatttaaccgctttacaacaaggtttaccgaatctgctt
aaacatatcagtaacctcaaaaatgtattcggcttaccggttgtggtcgcattaaaccgc
tttgtgtcagatactgatgcagaattagccctaattcagaccgcttgtgcgaaacaaggc
gtggaagtatcgctcactgaagtttggggtaaaggcggcgccggtggtgtggacttagca
caaaaagtgttaaaagcgattgatgaacaagagaaccgttttaatttcgtctatgacgta
aatgaaagcgtgcaaaacaagatcaaagcgatcgcacaaaaaatctatggtgcggatgat
gtgaattttagtgccgaagccttagcggaaattaaaaatctggaaaaattaggtttagat
aaattaccgatttgtatggcgaaaacacaatattcattaagcgataatgccaaattactc
ggttgcccaagcggttttaccgttaccgtacgtagtattagcgtctctgccggtgccggc
tttatcgttgcgatttgcggtagcattatgcgtatgccgggcttaccgaaagtgccggcg
gcaaatcgtattgatgtggatgaaaacggtttgattaccggtttattctaa

DBGET integrated database retrieval system