KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0854
Entry
APL_0854          CDS       T00476                                 
Symbol
metF
Name
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADH) [EC:1.5.1.54]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
apl00670  One carbon pool by folate
apl01100  Metabolic pathways
apl01120  Microbial metabolism in diverse environments
apl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:apl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    APL_0854 (metF)
Enzymes [BR:apl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.54  methylenetetrahydrofolate reductase (NADH)
     APL_0854 (metF)
SSDB
Motif
Pfam: MTHFR
Other DBs
NCBI-ProteinID: ABN73950
UniProt: A3N0L4
Position
991911..992792
AA seq 293 aa
MSYAKEIDHLNHTLADLNGNINASFEFFPAKNEKMEMLLWDSIHRLAPLKPKFVSVTYGA
NSGERKRTHSIVKRIQQDTGLAAAPHLTGIDANPEQLRIIAQDYWENGIRHIVALRGDEP
AGYAKKSFFAKDLVKLLKEVADFDISVAAYPEVHPEAKSAQSDLIYLKQKVEAGANRAIT
QFFFDIDSYLRFRDRCVTVGIDVEIVPGILPVTNFKQLQKMTKITNVKVPHWMHKMYEGL
DDDQTTRNLVAASIAMDMVKILSKEGVKDFHFYTLNHSELTYAICHALGVRPT
NT seq 882 nt   +upstreamnt  +downstreamnt
atgagctatgcgaaagaaatcgatcacttaaaccatacccttgccgatttaaacggcaat
attaacgcttcttttgaatttttccccgctaaaaacgaaaaaatggaaatgttactttgg
gattcgattcatcgacttgctccgcttaaacctaaattcgtttcagttacctatggtgca
aattccggcgagcgaaaacgtactcattcaattgtgaaacgtattcagcaagataccggt
ttagctgcagcaccgcatttaaccggtattgatgccaatcccgaacagctccgtataatt
gcgcaagattactgggaaaacggtattcgccatattgttgcactacgaggtgacgaacct
gccggttatgctaaaaaatccttttttgcaaaagatttagtaaaactcttaaaagaagtc
gcggattttgatatttcggttgccgcctatcccgaagtacatccggaggcaaaatcggca
caatccgacttaatttacttaaaacaaaaagtggaagccggtgctaatcgtgcgattacc
caattcttttttgatatcgacagttatcttcgattccgtgatcgctgtgtaaccgttgga
attgatgtggaaatcgtacctggcattttaccggtcacgaattttaaacaattacaaaaa
atgacaaaaattaccaatgttaaagtaccgcattggatgcataaaatgtatgaaggatta
gatgatgatcaaacaactagaaatttagttgccgccagtattgccatggatatggttaaa
attctctcaaaagagggcgtaaaagatttccatttctacacactgaatcactccgaatta
acctatgcgatttgccatgcattaggcgtacgaccgacttaa

DBGET integrated database retrieval system