KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0897
Entry
APL_0897          CDS       T00476                                 
Symbol
folD
Name
(GenBank) bifunctional protein FolD
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
apl00670  One carbon pool by folate
apl01100  Metabolic pathways
apl01120  Microbial metabolism in diverse environments
apl01200  Carbon metabolism
apl01240  Biosynthesis of cofactors
Module
apl_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:apl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    APL_0897 (folD)
Enzymes [BR:apl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     APL_0897 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     APL_0897 (folD)
SSDB
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH adh_short OCD_Mu_crystall
Other DBs
NCBI-ProteinID: ABN73993
UniProt: A3N0Q7
Position
1039775..1040632
AA seq 285 aa
MTAHIISGTAVAKQVKANIAEQIQAYTAQDKRKPGLAVILVGMDPASQVYVNSKRKSCAE
IGIESKSYDLPAETGEAELLAIIEQLNHDDSVDGILVQLPLPKQIDATKVTEAIVPHKDV
DGFHPYNVGRLCQKIPTLRSCTPYGVMKLLESTGVNLAGLHAVVVGASNIVGRPMAMELL
LAGCTVTITHSRTKDLAYHVSQADIVVAGVGKPNFVKGEWIKPGAIVIDVGINRVEGKLI
GDVEYSAAEAKASFITPVPGGVGPMTVAMLMQNTLQAYQVHLQAV
NT seq 858 nt   +upstreamnt  +downstreamnt
atgacggcacacattatctcaggcacagcggtggcaaagcaagttaaagcgaatatcgcc
gaacaaattcaagcctataccgcacaagataaacgtaaaccgggattagcggtgatttta
gtgggaatggatcccgcctctcaggtgtatgtgaatagtaaacgaaaaagttgtgccgaa
atcggtatcgaatccaaatcgtacgatctgcctgccgaaaccggtgaagccgaattactt
gcgattatcgaacaattaaaccatgacgattcggtcgatggcattctggtgcaattaccg
ctaccgaagcaaattgatgcgactaaagttaccgaagcgattgtgccgcataaagatgtg
gacggtttccatccttacaatgtcggacgtttatgccaaaaaattccgaccttacgctct
tgtacaccatacggcgttatgaaattactggaaagtaccggcgtgaatctcgccggatta
catgccgttgttgtcggtgcttcaaatattgtcggtcgtccgatggcaatggaactactg
cttgccggttgtaccgttaccatcacacacagccgcactaaagatttggcttatcacgtt
tcgcaagcggatattgtggttgccggagtcggcaaaccgaactttgtaaaaggtgaatgg
attaaaccgggtgcgattgtgattgatgtcggcattaaccgagtggaaggcaaattaatc
ggtgacgtggaatactccgctgcggaagctaaagcgagcttcatcacgccggtaccgggc
ggtgtcggtccgatgacggtagcgatgttaatgcaaaataccttgcaagcctatcaagtt
catttacaagcggtctga

DBGET integrated database retrieval system