KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0958
Entry
APL_0958          CDS       T00476                                 
Symbol
purH
Name
(GenBank) bifunctional purine biosynthesis protein PurH
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
apl00230  Purine metabolism
apl00670  One carbon pool by folate
apl01100  Metabolic pathways
apl01110  Biosynthesis of secondary metabolites
Module
apl_M00048  De novo purine biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:apl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    APL_0958 (purH)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    APL_0958 (purH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:apl04147]
    APL_0958 (purH)
Enzymes [BR:apl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.3  phosphoribosylaminoimidazolecarboxamide formyltransferase
     APL_0958 (purH)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.10  IMP cyclohydrolase
     APL_0958 (purH)
Exosome [BR:apl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   APL_0958 (purH)
SSDB
Motif
Pfam: AICARFT_IMPCHas MGS DUF3928 DUF4261
Other DBs
NCBI-ProteinID: ABN74054
UniProt: A3N0W8
Position
1100837..1102426
AA seq 529 aa
MAIQQALLSVSDKKGIVEFAQGLVARGVKLLSTGGTAKLLAEAGLPVTEVSDYTGFPEMM
DGRVKTLHPKVHGGILGRRGTDDEVMNRHGIERIDIVVVNLYPFAATVANPNCTLADAVE
NIDIGGPTMVRSAAKNHKDVAIVVNNNDFDAILAEMDQNQNELTLETRFNLAIKAFEHTA
QYDSMIANYFGKLVPPYQGAEEEDLTQVCGQFPRTLNLNFVRKQTMRYGENSHQNAAFYV
ENEVKEASVSTAKQLQGKALSYNNIADTDAALECVKEFAEPACVIVKHANPCGVALGKDI
LEAYNRAYQTDPTSAFGGIIAFNRELDGETAQTIAERQFVEVIIAPSVSEAAKAALAKKK
NVRVLECGEFTQAQKRLDFKRVNGGLLVQDADQGSVSIDDLQVVSERKPSKEELEDLLFC
WKVAKYVKSNAIVYAKNGQTIGIGAGQMSRVYSAKIAGIKAEDEGLQVAGCVMASDAFFP
FRDGIDAAAKVGITCVIHPGGSMRDQEVIDAANEHGMAMVLTGMRHFRH
NT seq 1590 nt   +upstreamnt  +downstreamnt
atggcgattcaacaggcgttattaagtgtgtctgacaaaaaaggtattgtagaatttgca
caagggctggtagctcgcggtgtgaaattactttcgacaggcggtacggcaaagctgtta
gctgaagctggcttaccggtcacggaagtatcggactacaccggcttccctgaaatgatg
gacggtcgcgtaaaaaccctgcatccgaaagtacacggcggtattcttggtcgccgcggt
acggatgatgaagtgatgaaccgacacggtatcgaacgtattgatatagtggtagtaaac
ttatacccgtttgcggcaaccgttgcgaatccaaattgcaccttagcggatgcagttgaa
aatattgatatcggcggcccgaccatggtgcgttctgcagcgaaaaaccataaagatgtg
gcgatcgtggtgaataataacgattttgatgcaattcttgccgaaatggatcaaaaccaa
aacgaattaacccttgaaacgcgtttcaacctggcaattaaagcatttgaacatacggca
caatacgattcaatgattgcaaactacttcggtaaacttgtcccgccataccaaggtgct
gaggaagaagatttaactcaagtctgcggtcaattccctcgtacattaaacttaaatttc
gtacgcaaacaaaccatgcgttacggtgaaaactcacatcaaaatgcagcattctatgta
gaaaacgaagtgaaagaagcttctgtttcaaccgcaaaacaattacaaggtaaagcactt
tcttataacaatattgcggataccgatgcggcacttgagtgcgtaaaagaatttgcagaa
ccggcttgcgtgattgtgaaacacgctaacccttgcggtgtggcattaggtaaagacatt
ttagaagcttataaccgtgcttaccaaaccgacccgacatcagcattcggcggtattatt
gctttcaaccgtgagttagacggtgaaacggcacaaacgatcgcagaacgccaatttgtg
gaagtgattattgctccaagcgtttcagaagcggcaaaagcagcgcttgcgaagaagaaa
aatgtgcgtgtcttagaatgtggtgaatttactcaagcgcaaaaacgtttagatttcaaa
cgtgtaaacggcggtttattagtgcaagatgcggatcaaggttcggtttcaattgatgat
ttacaagtggtatccgaacgtaaaccaagcaaagaagagcttgaagacttattattctgc
tggaaagtggcaaaatatgtgaaatcaaatgcgattgtctatgcgaaaaacggtcaaact
atcggtatcggtgcaggtcaaatgagccgtgtctattcagcgaaaattgccggtattaaa
gcggaagacgaaggcttacaagttgctggctgcgtaatggcttcagatgcgttcttccca
ttccgtgacggtattgatgcggcagctaaagtcggcattacttgcgtaatccatccgggt
ggctcaatgcgagatcaagaagtgattgatgctgctaacgaacacggtatggcaatggtc
ttaaccggtatgcgccatttccgtcactaa

DBGET integrated database retrieval system