KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_1587
Entry
APL_1587          CDS       T00476                                 
Symbol
fmt
Name
(GenBank) methionyl-tRNA formyltransferase
  KO
K00604  methionyl-tRNA formyltransferase [EC:2.1.2.9]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
apl00670  One carbon pool by folate
apl00970  Aminoacyl-tRNA biosynthesis
apl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    APL_1587 (fmt)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    APL_1587 (fmt)
Enzymes [BR:apl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.9  methionyl-tRNA formyltransferase
     APL_1587 (fmt)
SSDB
Motif
Pfam: Formyl_trans_N Formyl_trans_C
Other DBs
NCBI-ProteinID: ABN74671
UniProt: A3N2N5
Position
complement(1814950..1815900)
AA seq 316 aa
MSKLNIIFAGTPDFAAQHLQALLDSEHNVIAVYTQPDKPAGRGKKLQASPVKQLAEQHNI
PVYQPKSLRKEDAQAELKALNADVMVVVAYGLILPEAVLNAPKYGCLNVHGSLLPRWRGA
APIQRSIWAGDQETGVTIMQMDIGLDTGDMLHKVTTPIAADETSASLYAKLAELAPPALL
EVLNGLESQAFKAEKQDDALSNYAEKLSKEEAKLDWNLTACQLERNIRAFNPWPISFLTL
EVDGVEQSVKVYQANVLPHQAKAAGTVLQADKNGIQIATQEGVLNITQLQPSGKKPMSVQ
DFLNGRADWFAVGKQL
NT seq 951 nt   +upstreamnt  +downstreamnt
atgtcaaaacttaatattatttttgccggcacacctgattttgccgcacaacacttacaa
gcattattagattcagaacataatgtgattgcagtttatacccaaccggacaaacctgcc
ggcagaggtaaaaaactgcaagccagcccggttaaacaattagccgaacaacataatatt
ccggtatatcaaccaaaatctttacgtaaagaagacgcacaagcggaattaaaagcactg
aatgccgatgtaatggttgtagtggcttacggtttaatcttaccggaagcggtactgaat
gcgccgaaatacggttgtttaaatgtgcacggttcgctgttaccacgctggcgtggagcg
gcaccgattcaacgctcgatttgggcgggcgatcaggaaactggcgtgaccattatgcaa
atggatatcggcttagataccggcgatatgttacataaagttaccacaccgattgccgca
gacgaaacctccgcttcgttatatgccaaattagccgaacttgcaccgccggcgttatta
gaggtgttaaacgggttagaaagccaagcgtttaaagcggaaaaacaagatgatgcgctt
tccaactatgcggaaaaactttcaaaagaagaagcaaaattagactggaatttaaccgct
tgtcagctggaacgcaatattcgtgcatttaacccatggcctattagctttctcacatta
gaggtggacggtgtagagcaaagcgtgaaagtgtatcaagcgaatgtgttaccgcatcaa
gctaaagcggcaggtacggtcttacaagcggataaaaacgggattcaaattgcaacacaa
gaaggcgtgttaaatattactcagttacaaccttccggcaaaaaaccgatgtccgtgcaa
gacttccttaacgggcgtgccgattggtttgcagtgggaaaacaactctaa

DBGET integrated database retrieval system