KEGG   Actinosynnema pretiosum: CNX65_21845
Entry
CNX65_21845       CDS       T05092                                 

Definition
(GenBank) SAM-dependent methyltransferase
  KO
K13330  dTDP-4-amino-2,3,4,6-tetradeoxy-D-glucose N,N-dimethyltransferase [EC:2.1.1.324]
Organism
apre  Actinosynnema pretiosum
Pathway
apre00523  Polyketide sugar unit biosynthesis
apre01100  Metabolic pathways
apre01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apre00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CNX65_21845
Enzymes [BR:apre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.324  dTDP-4-amino-2,3,4,6-tetradeoxy-D-glucose N,N-dimethyltransferase
     CNX65_21845
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12 Methyltransf_31
Other DBs
NCBI-ProteinID: ATE55606
UniProt: A0A290Z9E3
Position
5153407..5154147
AA seq 246 aa
MTEALDRAVPAGVGEHVEIYEVVHSARGRDWVAEADLVAKLVLARNPWAGSLLDVACGTG
AHLRRFGSRFARVAGVEPSPAMRGIAEARLPGVPVHAGDVRGFDLGVRFDAVTCLRFAIA
HARSLAELGAIAECFARHLVHGGVLVVEPWWFPERFPEGCVSGSVVERDGVVVSRLSHSV
RRGRTTSTTVRYTVAEASGIRDFTEREELGLFGEEEYLAAFAAAGISAAHVPGGLNGRGV
FVGVRC
NT seq 741 nt   +upstreamnt  +downstreamnt
gtgaccgaggcgcttgaccgggcggtgcccgccggggtcggggagcacgtggagatctac
gaggtggtgcactccgcgcgcgggcgggactgggtcgcggaggcggacctggtcgccaag
ctggtgctggcgcgcaacccgtgggccgggtcgctgctggacgtggcctgcgggacgggg
gcgcacctgcggcggttcgggtcgcggttcgccagggtggccggggtggagccctcgccc
gccatgcgcgggatcgccgaggcccggctgccgggggtgccggtgcacgccggggacgtg
cgcgggttcgacctcggggtgcggttcgacgcggtgacgtgcctgcgcttcgcgatcgcc
cacgcccggtcgctcgcggagctgggggcgatcgcggagtgcttcgcccggcacctggtg
cacggcggggtgctggtggtggagccgtggtggttccccgagcggttcccggaggggtgc
gtgagcgggtcggtggtcgagcgggacggggtggtggtgagccggttgtcgcactcggtg
cggcgggggcggacgaccagcacgacggtgcggtacacggtggcggaggcgagcgggatc
cgggacttcaccgagcgggaggagctggggctgttcggggaggaggagtacctggcggcg
ttcgcggcggcggggatcagcgcggcgcacgtgccgggcgggttgaacgggcggggggtg
ttcgtgggggtgcggtgctga

DBGET integrated database retrieval system