KEGG   Arthrobacter sp. Rue61a: ARUE_113p00080
Entry
ARUE_113p00080    CDS       T02215                                 

Symbol
meqE
Name
(GenBank) 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase MeqE
  KO
K21821  3-hydroxy-2-methylquinolin-4-one 2,4-dioxygenase [EC:1.13.11.48]
Organism
arr  Arthrobacter sp. Rue61a
Brite
KEGG Orthology (KO) [BR:arr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ARUE_113p00080 (meqE)
Enzymes [BR:arr01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.48  3-hydroxy-2-methylquinolin-4-one 2,4-dioxygenase
     ARUE_113p00080 (meqE)
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4
Other DBs
NCBI-ProteinID: AFR34517
UniProt: O31266
Structure
Position
pAL1:11551..12381
AA seq 276 aa
MTDTYLHETLVFDNKLSYIDNQRDTDGPAILLLPGWCHDHRVYKYLIQELDADFRVIVPN
WRGHGLSPCEVPDFGYQEQVKDALEILDQLGVETFLPVSHSHGGWVLVELLEQAGPERAP
RGIIMDWLMWAPKPDFAKSLTLLKDPERWREGTHGLFDVWLDGHDEKRVRHHLLEEMADY
GYDCWGRSGRVIEDAYGRNGSPMQMMANLTKTRPIRHIFSQPTEPEYEKINSDFAEQHPW
FSYAKLGGPTHFPAIDVPDRAAVHIREFATAIRQGQ
NT seq 831 nt   +upstreamnt  +downstreamnt
atgaccgacacatatctgcatgaaacgctagtcttcgacaacaagctctcctatatcgac
aatcagcgggacaccgacggccccgcgatcctcctcctacccgggtggtgccacgaccac
cgcgtctacaagtacctgatccaggagcttgacgcagacttcagggtaattgtccctaac
tggcggggtcacggactctcgccctgcgaggtcccagactttggctatcaggaacaggtg
aaggacgcgttggagattctcgaccaactcggcgtggagacctttcttccggtatctcat
tctcacggcggctgggttcttgtagagctgcttgagcaggccggccccgaacgggcgccg
cgaggcatcatcatggactggctaatgtgggcacccaagccggacttcgccaagagcttg
accctactaaaagaccccgagcggtggcgcgagggaacgcacggcctgttcgacgtctgg
cttgacgggcatgacgagaaacgagtccgtcatcacctcctggaggagatggcagactac
ggctacgactgctggggacgatccggaagggtcatcgaggacgcttacggcaggaacggg
tcaccaatgcagatgatggcaaacctcaccaagacgcgaccgatccggcacatcttctcg
cagccaacagagcctgaatacgagaaaatcaactccgatttcgccgagcagcatccctgg
ttctcctacgccaagttgggcgggccgacccacttccccgccatcgacgtcccggaccga
gcggcagtccatatccgtgaatttgccacggcaatccgccaaggccagtaa

DBGET integrated database retrieval system