Arthrobacter sp. Rue61a: ARUE_c09890 Help Entry ARUE_c09890       CDS       T02215                                  Name (GenBank) MutT/nudix family protein   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism arr  Arthrobacter sp. Rue61a Brite KEGG Orthology (KO) [BR:arr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:arr03400]     ARUE_c09890 Enzymes [BR:arr01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      ARUE_c09890 DNA repair and recombination proteins [BR:arr03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     ARUE_c09890  Prokaryotic type     ARUE_c09890 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX PorB DUF7440 Motif Other DBs NCBI-ProteinID:  AFR27911 Position complement(1055191..1055604) Genome browser AA seq 137 aa AA seqDB search MSGTGTDLIIVSAVCVYNNAGQLLTVRKSGTDKFMHPGGKPEPGETAAEAASRELLEEVG IAVAPNLLEPLGVWLAVAANEAATNIEATVFTAPGTWEAHPSAEIAEIRWLDLDAPLPPD LAPLLTDHVLPALTPPK NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgagtggaaccggcacggacctgattattgtcagcgccgtctgcgtctacaacaacgcc ggccaactgctgactgtccgcaagagcggcacggacaagttcatgcacccgggcggcaag cccgagccaggcgaaaccgctgctgaagccgcttcgcgggagcttttggaggaagtgggc atagcggtagcaccgaacctcctggagccgctcggcgtgtggttggctgtggcagccaat gaggcagcgaccaatatcgaagccaccgtgttcactgcacccggaacatgggaggcgcac ccttcggcggagatcgccgagatccgctggctggacctcgacgcgccgcttcccccggac ctggcaccgctgttgacggaccacgtacttccagcgctcaccccgcccaagtag

All links   Gene (2) NCBI-PROTEINID (1) OC (1) Protein domain (3) Pfam (3) All databases (5) Download RDF

DBGET integrated database retrieval system