KEGG   Arthrobacter sp. ZXY-2: ARZXY2_4561
Entry
ARZXY2_4561       CDS       T05201                                 
Name
(GenBank) hypothetical protein
  KO
K19187  6-hydroxypseudooxynicotine dehydrogenase subunit gamma [EC:1.5.99.14]
Organism
arx  Arthrobacter sp. ZXY-2
Pathway
arx00760  Nicotinate and nicotinamide metabolism
arx01100  Metabolic pathways
arx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:arx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ARZXY2_4561
Enzymes [BR:arx01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.99  With unknown physiological acceptors
    1.5.99.14  6-hydroxypseudooxynicotine dehydrogenase
     ARZXY2_4561
SSDB
Motif
Pfam: MoCoBD_2 MoCoBD_1 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AOY74060
UniProt: A0A1D9FFU9
Position
pZXY21:189022..191406
AA seq 794 aa
MMAKAKALIPDNGRAGADEGNRQAWIGQEVLRREDRRLLTGTATFAGDLGVPGQLHMRIV
RSTQAHARIVSIDATEAEKTPGVRMVITSEHTRHLGSVLLEELGYHEIYENIEDFSHPVL
AVDKVLYVGQPVVAVLAVDPYLAEDAAELVSIEYEPLPVLLDPEEALTGKVELFPGRGNE
GARIKKAYGDIDRAFAEAEHVIRHKYVTNRHSGVPMEPRAVVVQPDPARDTLFIWGTVHV
HDNRRIIAKMLNLPEVNVRMKHVEIGGSFGVKGGVFPENVVAAWAARTLGVPIKWTEDRV
EHMTSTSHAREMVHKLELALDAEGRILGMKDEIFHNHGAYFRQAEPLVSDITAGIVFGPY
RVPAYDATLHAVFTNKTPVGAYRAPGRYESTFARERIFDLACEEIGLSKTEFRRRNLLTA
EDLPWTPGLDIVHEPYHFDSGDVVKHFNEALEAANFSEWLEESKRLRADGRKVGVGLGVL
MDKAGLGLFETGGVEVSRAGRVTVKTGGSSVGQGIETVLAQIVAEELQIAPENIDIVHSD
TELIPDGVGSWSSRSTVLAGGAARKAALAVVEKARRLASEMLEADPDDLELTAGSFKVKG
TDQQISLYEIAAARDPFTARADNDEPGLAADAVYMNNAMNYPYGVTLVQIELDPDTGGHR
ILRFSTSTEAGRVINPLTTRGQIIGAAVQGIGGALYEEFLYEEDGQPITTSFMDYLLPSA
QEMPNVDCFVTEDAKSPDNPFGAKGLGEIGIIAAGAAIASAIDDAIADGVHTDRLPVTPE
QIFSRCQGLNKAER
NT seq 2385 nt   +upstreamnt  +downstreamnt
atgatggcaaaggctaaagcgctcatccctgacaacggtagagccggcgcggacgagggc
aacagacaggcatggataggccaggaggttctgcggcgggaggaccgccggctactcact
ggaacagcaacatttgctggcgatctgggagtgcccgggcaattgcatatgcgcattgtc
cgttcaacacaggctcatgcccggatcgtgtccatagacgccactgaagctgaaaagact
ccaggcgtacgaatggttatcacgtctgagcacacgcggcacctgggttcggttctcttg
gaagagctgggatatcacgaaatttatgaaaacattgaggacttcagtcaccccgtccta
gcagtagacaaggtgctatatgtggggcagccggtggttgctgtacttgctgttgatcct
tatcttgccgaagacgcagctgagcttgtctctatcgagtatgagccgctcccggtcctc
ttggatccggaagaagcattgaccggtaaggtcgagctctttccggggcgcggcaatgaa
ggtgcgcgcatcaaaaaggcctacggcgatattgatcgcgccttcgccgaagcagagcac
gtcattcgccacaagtacgtcacgaaccgccattccggtgtacctatggaaccgcgggcc
gtagtggtacagcccgacccagcaagggacacgctgttcatctggggcaccgtgcatgtg
catgacaaccggaggatcatcgccaagatgctgaatcttcccgaggtcaacgtacggatg
aaacacgtagagatcggcggcagttttggcgtgaagggcggagtcttcccagaaaacgtt
gttgcagcatgggcagcccgtacgttgggagtcccgatcaaatggactgaggaccgagtc
gagcacatgacttccacgtcccatgcccgggaaatggtgcataagctcgaactcgcgctc
gatgctgagggcagaatcctgggtatgaaggacgaaattttccacaaccatggtgcctat
ttcaggcaggcggagccgctagtcagcgacattactgccggcattgtgttcggcccctat
cgggtccctgcctacgatgctactctgcacgccgtcttcaccaacaaaacacctgtcgga
gcttaccgcgcgcctggacgctacgagtccactttcgctcgagagcggatctttgatctg
gcgtgtgaagaaatcggtctcagcaagacggaatttcgccgacgaaaccttcttacggct
gaagacctcccttggacaccgggtcttgacatcgtccacgagccctaccacttcgactcg
ggagacgtagttaagcatttcaacgaagctctggaggcagcaaacttctcggagtggctt
gaggaatccaaacgactacgggcggatggccgaaaagtcggcgtaggcctcggcgtgctg
atggataaggcaggtctggggcttttcgaaaccggcggcgttgaagtcagccgtgccggc
cgcgtcacggtcaaaaccggaggttcctcggtcgggcagggaatcgaaacggttctggcc
cagattgtcgccgaagagctacagatcgctcccgaaaacattgacatcgtccatagcgat
acagagcttattccggacggtgtgggttcctggtccagccgttcaactgttcttgctgga
ggtgctgcccgcaaagctgcgcttgcagttgtggaaaaagccagacgcttggccagtgag
atgctggaagctgatccggacgacctcgaattaactgcaggcagttttaaggtcaagggc
actgatcagcaaatctcgctgtacgagatcgcagcggcgagggaccccttcacggcgagg
gccgacaatgatgaacccggcctagcagcggacgcggtctacatgaacaacgccatgaac
tatccatacggggtaacactcgtacaaatcgaactagatcctgacacaggcggtcatagg
attcttcgcttttccacttccacggaagcaggaagggtaatcaaccccctgaccacgagg
ggccagatcataggtgcggcggttcaaggcattggaggcgccctgtacgaggagttcctc
tacgaagaggatggacagccgattacgacgtcgttcatggactacttgttgccaagcgct
caggagatgccgaacgtcgactgttttgtaactgaagatgccaagtcaccggacaacccc
tttggcgccaagggccttggggaaattggcatcattgcggccggcgcggcaatcgcttca
gctatcgatgatgccatcgccgatggcgtacatactgaccgtttgccagtcacccccgag
cagatcttcagccgctgtcaaggtttgaacaaagcagaacggtaa

DBGET integrated database retrieval system