KEGG   Arthrobacter sp. ZXY-2: ARZXY2_4583
Entry
ARZXY2_4583       CDS       T05201                                 

Name
(GenBank) putative glycine cleavage system T protein
  KO
K19191  4-methylaminobutanoate oxidase (formaldehyde-forming) [EC:1.5.3.19]
Organism
arx  Arthrobacter sp. ZXY-2
Pathway
arx00760  Nicotinate and nicotinamide metabolism
arx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:arx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ARZXY2_4583
Enzymes [BR:arx01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.19  4-methylaminobutanoate oxidase (formaldehyde-forming)
     ARZXY2_4583
SSDB
Motif
Pfam: DAO GCV_T FAO_M GCV_T_C Pyr_redox_2 Pyr_redox_3 NAD_binding_8 Amino_oxidase HI0933_like ApbA Pyr_redox
Other DBs
NCBI-ProteinID: AOY74082
UniProt: A0A1D9FFI4
Position
pZXY21:209451..211925
AA seq 824 aa
MDRLVDRDISASMFTATSHDPLPTHVRTVVVGGGIIGASIAYHLSAAGENDTLLLESNVL
GSGTSWHAAGLVTGARGTTTMTKLAKYGLDFYSRLEQMSGLDVSFQRCGSLSVARTAGRV
DELLYAKDVADQQGVRTEWLTEDRYKELWPLATYSGVAGALLLPDDGHINPGHATVALAK
LAHSLGTQIRENVAVHKVLRQGDLVVGVLTDQGIVHCDRVILACGLWTRDLAATAGVKVP
LYAAEHIHVRSAEIDGAVPELPVYRDLDNSYYIRHEAGRLLVGAFEPDGLPRPVEEIPSN
GFAEFGPEWEHFAPIRAKAEGVVPALASAGFDRFLNAPESFTPDANFAVGETSELSNLFV
AAGFNSQGIIFAPGIGKELAEWVISGTPGFDSSAVDVQRFSGHQNNRNYLKARTKEGLGR
LYAMHWPNLQMETGRNVRRTPLHARLAELGACFGEVNGGERANWYGAPGTSPTYDYSYGR
PNWFDRVAEEHKAAREGVVLFDLSPFAKFEVAGPDALEVCQMAATADIDVETDKAVYTLF
LNDRAGIELDGTITRLGLDRFLVVTPSFTQQKTAAYLKRIARGKAAAVFDCTAALATIGV
MGPKSRELLSRISPEDWSDEAQRYTHGRMVEIADGYAYSLRVSFVGELGYELYPSADMAV
NVLDALWEAGQDLGLKLAGYHALDSLRSEKGFRHLGHDIGPIDDPYSAGLRFTISMDKPG
GFLGKDALLKLDPTAPDHRTVYVALEDPDPVFVHDETVYCNGLPVGRMTSGSYGHTLGRA
VGIAALEPDADLSGDFEVQCKGRLYPAKVSRRPFYDPKGERLRG
NT seq 2475 nt   +upstreamnt  +downstreamnt
atggacaggcttgtcgaccgcgacataagcgccagcatgtttacagctacttcccatgac
ccgttgccgacccacgtccgtacagtcgtggtcggtggcggcattatcggtgccagcatt
gcctaccacctttcagctgcgggtgagaacgacaccctacttttggagagcaacgtcctg
ggcagcggcacctcttggcacgccgcaggcttggtcactggagcgcgcgggaccacgact
atgacaaagctggccaagtacggcttggacttttatagccggctcgagcagatgtccggg
ctggacgtctcatttcagcgttgcgggtccctcagtgttgcgcgaaccgccggtcgcgtt
gacgagcttctttatgcaaaggacgtggccgaccagcagggcgtaagaactgaatggcta
actgaggaccgatacaaggaattgtggcctctcgcaacctactcaggggttgccggagcg
ctcctgctgcctgacgatggtcacatcaacccgggtcacgcaacagtggctctcgctaaa
ctcgcccatagccttgggacccaaatacgcgaaaacgttgccgtacacaaggtacttcgt
cagggcgatctcgtcgtcggcgtactcacggatcaaggaatcgtgcactgcgatcgggtg
attttggcgtgcggtttgtggactcgtgatctcgcggccaccgccggggtgaaggtcccc
ttgtacgccgccgaacacatccacgtccgatctgcagaaattgacggggctgtccctgag
ctgcccgtatatagggatctagacaacagctactacatccgtcacgaggccgggaggctc
ttggttggcgcattcgagcctgacgggcttccacgccccgttgaggagattccctccaac
ggcttcgccgagttcggaccggagtgggaacacttcgctccgatcagagcgaaggccgaa
ggggtagtgccggcacttgcttcggcgggattcgaccgattcctgaacgctcccgaaagc
ttcaccccagacgccaactttgccgtgggtgaaacctccgaactttccaatctcttcgtg
gcagcaggcttcaattctcaggggattatctttgctcccggcataggtaaggagctggcg
gagtgggtcatttcaggtacgcccggttttgactcatccgcggtggacgtgcagcgcttt
tcgggacaccaaaacaaccgaaactatctcaaggcccgaactaaggagggcctcggtcga
ctttatgcaatgcactggccgaacttgcagatggaaactggccgcaacgtccgtcgaacg
ccccttcacgcgcgcctcgctgagctcggggcctgctttggtgaagttaacggtggggag
cgggcaaactggtacggggccccgggaacctctcccacctacgactacagctatggacgc
ccgaactggttcgaccgtgtcgccgaagaacataaagcggcgcgtgagggcgtggtcctt
ttcgatctgagtccttttgcaaaattcgaagttgctggtcctgatgctcttgaggtgtgt
cagatggccgcaacagcagacatcgacgtcgagaccgataaagcggtctataccctcttc
ttaaatgaccgagcggggatcgaactagacggaaccatcactcgtcttggccttgaccgg
ttcttggtcgttaccccgtcatttacccagcaaaagacggcagcatacctcaaacgaatc
gctcggggtaaagcggccgcggtatttgactgcacggcggctctggccacaatcggagtc
atgggaccgaaaagccgagaacttcttagcaggatttcgccggaagactggtccgacgaa
gcacagagatacacccacggacgcatggtagaaattgcagacggctatgcgtacagtttg
cgcgtgagcttcgtaggcgaattgggctacgagttgtacccaagtgccgacatggcagtc
aacgtcctggacgcgctgtgggaagcagggcaggatcttggactcaaattggccggatac
cacgccttggattcactgcgcagcgagaagggattcaggcacctgggtcacgacatcggg
cccattgacgatccctattcggcaggccttcgtttcactatctcgatggacaaaccggga
ggcttcctaggcaaagacgccctcctcaagctcgaccccacagcgcccgatcatcgaacg
gtgtatgtagcactggaagaccccgatccggtgttcgtacatgacgagaccgtatactgt
aacggccttccagtcggacgcatgacgagcggcagctatggccacacgctgggacgcgca
gtcggaattgccgctcttgaacctgatgcagatctctccggtgacttcgaggtccagtgc
aagggacggctttaccccgcgaaggtctcccggcggccgttctacgatccaaagggcgaa
cggctccgcggttag

DBGET integrated database retrieval system