KEGG   Athalassotoga saccharophila: ATHSA_1345
Entry
ATHSA_1345        CDS       T06407                                 

Name
(GenBank) hypothetical protein
  KO
K21056  alpha-D-ribose-1-phosphate 5-kinase (ADP) [EC:2.7.1.212]
Organism
asac  Athalassotoga saccharophila
Brite
KEGG Orthology (KO) [BR:asac00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ATHSA_1345
Enzymes [BR:asac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.212  alpha-D-ribose-1-phosphate 5-kinase (ADP)
     ATHSA_1345
SSDB
Motif
Pfam: PfkB
Other DBs
NCBI-ProteinID: BBJ28432
Position
complement(1311933..1312679)
AA seq 248 aa
MIDILGGAFRDILFYGQIHAEDVIEMSGGTGYNVFAGLREIGIESTFHCAVGDDWPFENL
RHVNGKSGIFVCRNETEVLAVYRGVNLDIPVDDFKSKVLFSTLECGGDTFEKYAKKMKNE
GGIVILDPSPSFEWREEYVSLCDVLIPNEREFESISPPKFKEVFLKLGENGGKYIKDNVE
IYKNISKRGDFPLGCGDAFDVGIIYGLLNGKGPKRTLEIAVNLGEIASFFRGSSSAVIKA
VRKANLKS
NT seq 747 nt   +upstreamnt  +downstreamnt
atgatagacatactcggcggtgcattcagggatattcttttttacgggcaaattcacgca
gaagacgtgatcgaaatgtcaggtggcacgggatacaatgtttttgcgggattacgagaa
attggaatagaatcaacctttcattgtgccgtcggggatgattggccctttgaaaatcta
agacacgtgaatggtaaaagcggtatctttgtctgcagaaatgaaacggaggtacttgca
gtatacagaggggttaatttggacatacccgttgatgatttcaaatcaaaagtgcttttt
tcaactcttgaatgcggaggagatacatttgaaaaatacgcaaaaaagatgaaaaatgag
ggaggaatcgtgattttagatccatcgccttcttttgaatggagagaggaatacgtaagt
ctttgcgatgttttgatcccgaacgaaagagagtttgaaagcatctctcctccaaaattc
aaagaagttttcctaaaactcggcgagaatgggggtaaatatatcaaagataacgttgag
atatacaaaaatatctctaaaaggggagattttcccctcggatgtggagatgcctttgat
gtcggcatcatctacggccttttaaatggaaagggacctaaacgtactttagaaatagcc
gtaaatcttggcgaaatcgcttcattttttcgtggcagttcctctgccgtaatcaaggca
gttagaaaggcgaatttgaaatcttaa

DBGET integrated database retrieval system