KEGG   Candidatus Arthromitus sp. SFB-rat-Yit: RATSFB_1173
Entry
RATSFB_1173       CDS       T01624                                 

Gene name
npmA
Definition
(GenBank) 16S rRNA methylase
  KO
K18846  16S rRNA (adenine(1408)-N(1))-methyltransferase [EC:2.1.1.180]
Organism
asb  Candidatus Arthromitus sp. SFB-rat-Yit
Brite
KEGG Orthology (KO) [BR:asb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:asb03009]
    RATSFB_1173 (npmA)
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:asb01504]
    RATSFB_1173 (npmA)
Enzymes [BR:asb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.180  16S rRNA (adenine1408-N1)-methyltransferase
     RATSFB_1173 (npmA)
Ribosome biogenesis [BR:asb03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    RATSFB_1173 (npmA)
Antimicrobial resistance genes [BR:asb01504]
 Gene variants
  Aminoglycoside resistance genes
   16S rRNA methyltransferases
    RATSFB_1173 (npmA)
SSDB
Motif
Pfam: Methyltransf_4 Methyltransf_31 DOT1 Methyltransf_25 VPS13_mid_rpt MTS
Other DBs
NCBI-ProteinID: BAK81735
UniProt: G2IF11
Position
complement(1358413..1359054)
AA seq 213 aa
MKILRSSKEIELSREEFLNKIKSYDDLVIDLGTGQGAFVYFSALENKNKFYVGLDSCGDS
MKKYAIKQYKNKLENLVYIIMNAQNIDNLLYNMFSEVYINLPWGSLLEGIFKEELGIIYN
ISKLLVDSGKMKICFSYNDKFEKMEIEKRNLPDLNESYFDDFKMLYSKYNIEIHDINLVL
KDEIPFESKWVKVLGESNRREFYIINGYKKRVQ
NT seq 642 nt   +upstreamnt  +downstreamnt
atgaagatacttaggagtagcaaggaaattgagttaagtagagaggaatttttaaataaa
ataaaatcatatgatgatttggtaattgatttgggaacaggacaaggagcatttgtatat
ttcagtgctttagagaataaaaataaattttatgtaggattagattcttgtggagattct
atgaagaagtatgcgattaaacaatataaaaataagttagagaatttggtttatataatt
atgaatgctcaaaatatagataatttattatataatatgttttcagaagtttacataaat
ttaccgtggggtagtttgcttgaaggtatatttaaagaagagctaggtattatatacaac
atatctaagttgcttgtagatagtggaaaaatgaaaatatgtttttcatataatgataaa
tttgagaaaatggagatagagaagagaaatttgccagatttaaatgagagttattttgat
gattttaaaatgctatattctaaatataatatagaaatacatgatattaatttggtgtta
aaagatgaaattccttttgaaagtaaatgggttaaggttttaggagagagtaataggagg
gagttttatattataaatggatataaaaaaagagtgcagtag

DBGET integrated database retrieval system