KEGG   Candidatus Arthromitus sp. SFB-mouse-Japan: SFBM_1345
Entry
SFBM_1345         CDS       T01591                                 

Definition
(GenBank) rRNA methyltransferase
  KO
K18846  16S rRNA (adenine(1408)-N(1))-methyltransferase [EC:2.1.1.180]
Organism
asf  Candidatus Arthromitus sp. SFB-mouse-Japan
Brite
KEGG Orthology (KO) [BR:asf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:asf03009]
    SFBM_1345
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:asf01504]
    SFBM_1345
Enzymes [BR:asf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.180  16S rRNA (adenine1408-N1)-methyltransferase
     SFBM_1345
Ribosome biogenesis [BR:asf03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    SFBM_1345
Antimicrobial resistance genes [BR:asf01504]
 Gene variants
  Aminoglycoside resistance genes
   16S rRNA methyltransferases
    SFBM_1345
SSDB
Motif
Pfam: Methyltransf_4 Methyltransf_31 VPS13_mid_rpt Methyltransf_25 DNA_pol3_a_NII
Other DBs
NCBI-ProteinID: BAK57104
UniProt: F9VLU6
Position
complement(1468597..1469241)
AA seq 214 aa
MRILRSSKEIELGNEDFLDKIKSYDKLIIDLGTGQGAFVYFSALDNKNNFYIGLDSCGNS
MKKYAIKQYKNKVSNLIYIIMNVQNIDNLLYNMFSEVYINLPWGSLLEGLFKEELGIVHN
ISKLLIDGGMIKICFSYNDKFEKMEIEKRNLPLFNDEYFRNIFRPLYYKYNIEIEEINLI
LKDDIPFESKWAKVLGESNRREFYIINGYKKRVQ
NT seq 645 nt   +upstreamnt  +downstreamnt
atgaggatacttaggagtagtaaggaaattgagttaggtaatgaagattttttagataag
ataaagtcgtatgataagttgataattgatttgggtacaggacagggagcatttgtatat
tttagtgcattggataataaaaataatttttatattgggttagattcttgtggaaattct
atgaaaaagtatgcaattaagcaatataaaaataaggtaagtaatttaatttatattatt
atgaatgttcagaatatagataacttattatataatatgttttcagaagtttatataaat
ttaccttggggtagtttacttgaaggtttatttaaggaagaactaggtattgtacataat
atatctaaattattgatagatggtggaatgattaaaatatgtttttcctataatgataaa
tttgaaaagatggagatagaaaagaggaatttgcctttatttaatgatgagtattttaga
aatatttttagaccgttatattataaatataatatagaaatagaagagattaatttaata
ttaaaggatgatattccttttgagagtaagtgggctaaagttttaggtgagagtaataga
agagaattttatattataaatggttataagaaaagagtgcagtga

DBGET integrated database retrieval system