KEGG   Archaeoglobus sulfaticallidus: Asulf_01565
Entry
Asulf_01565       CDS       T02642                                 

Name
(GenBank) Conserved protein/domain typically associated with flavoprotein oxygenase, DIM6/NTAB family
  KO
K18915  ferric-chelate reductase [NAD(P)H] [EC:1.16.1.10]
Organism
ast  Archaeoglobus sulfaticallidus
Brite
KEGG Orthology (KO) [BR:ast00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Asulf_01565
Enzymes [BR:ast01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.10  ferric-chelate reductase [NAD(P)H]
     Asulf_01565
SSDB
Motif
Pfam: Flavin_Reduct Trp_leader2
Other DBs
NCBI-ProteinID: AGK61542
UniProt: N0BGZ8
Position
1401557..1402066
AA seq 169 aa
MNPQALYKISYGLYVVASMKDGRFNAQIANTVFQVTSQPVKVAVCINKQNLTHEFIEHSG
LFSVSILKKETPMKFIGTFGFRSGRDIDKFEGVNYITGKKGTPIVVDNSVAYIEAEVVNS
LDVGSHTLFVGEVIDAEIFDDGEVMTYDYYHSIKKGKTPKTATVYFEQK
NT seq 510 nt   +upstreamnt  +downstreamnt
atgaacccacaggctctctataagataagctacgggctttatgttgtagctagtatgaaa
gacgggaggttcaatgcccagatagcaaacacggtttttcaggtgacatctcagcctgta
aaggttgcagtgtgtataaacaagcagaatttaacccacgagttcatcgaacattctgga
ctgttttcggtttcgattttgaagaaagagacaccgatgaagttcatcggaaccttcggg
tttaggagtgggagggacatcgataaattcgaaggtgtgaattatatcacaggaaagaaa
ggaacacctatagttgttgacaactctgtcgcatacatcgaagctgaagttgtgaattct
ctggatgttggaagtcacaccctcttcgttggagaggtcatagatgcagaaatttttgat
gacggagaggttatgacatacgactactaccactcgataaagaagggcaaaactccgaaa
acggcaacggtgtatttcgaacaaaaatga

DBGET integrated database retrieval system