KEGG   Actinia tenebrosa (Australian red waratah sea anemone): 116308142
Entry
116308142         CDS       T07455                                 

Name
(RefSeq) allene oxide synthase-like isoform X1
  KO
K17874  9-divinyl ether synthase [EC:4.2.1.121]
Organism
aten  Actinia tenebrosa (Australian red waratah sea anemone)
Brite
KEGG Orthology (KO) [BR:aten00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:aten00199]
    116308142
Enzymes [BR:aten01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.121  colneleate synthase
     116308142
Cytochrome P450 [BR:aten00199]
 Cytochrome P450, plant type
  CYP74 family
   116308142
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 116308142
NCBI-ProteinID: XP_031574381
Position
Unknown
AA seq 464 aa
MFRSKSPVVEPLGDQLEKGRIPGKDGMKFFHLVKLIRNGHGYFTKRREQFQSTVFRVNIG
VKGIAVCDRKGLEALFDLEKIYKEPAFGRLNYNLSLLDGYTPSIFTNGVEHEKQKAFLMK
ICKIAQEADILKTTKNVVPTYLERWHKADAKTKANWEAEIMAMTSDIFTEAFLGIRVDPD
DMQGMLKGSWTKSKRTLKRSLECAXKIKEKFRECPKLCSILELAKEMGLSDEQAIMDILF
MLNFNAYGGISGALRSSIAWLYNLDPRVRQELEQEILENIDKDDGITEEALKKMNLMDRY
LLEVFRMSPPVPVIFGRARKDFLMDSGSGSVQVKTGELLIGNCYLVHRDPSVFHKPDEFM
PSRFEDESLLDHIVFSNGPYREAATPKNHHCPGKEIIFMILKSVLIQVMMCCDYTFTERP
YWTEKRLRRLGCPDNNMELSSFTYTPKSPIIKVHLLEVEDFDGK
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgtttcgctcaaaatcaccagttgttgaaccgcttggagatcaactagagaaaggcaga
atacctggaaaagatggcatgaaattctttcaccttgtaaaactcattaggaacgggcat
ggttactttacgaagagaagagaacagttccaaagcacagtgttcagagtcaacattgga
gtcaaggggattgctgtttgtgacagaaagggattggaagcattgtttgaccttgagaag
atttacaaagaacctgcttttggtcgtctgaattacaacttatctctactggacggatac
acgccatctatttttaccaacggcgtagaacacgagaagcagaaagcttttctcatgaag
atatgtaagatcgcgcaggaagcggacatattgaaaactaccaaaaacgttgtaccgacg
taccttgaacgctggcataaagcagatgcgaaaacaaaagccaactgggaagcagagatt
atggccatgacaagtgatatctttaccgaagcatttcttgggatacgtgttgacccagac
gatatgcagggaatgctgaaaggctcttggacaaaaagcaaacgcacattaaaaagaagt
ttggaatgtgccaakaaaatcaaggaaaagttcagggagtgtcctaaattatgcagtata
cttgagctggcaaaagaaatggggctgtcagatgaacaagctattatggatattcttttt
atgctcaacttcaacgcgtatggaggaataagcggtgcattgcgatcaagcattgcttgg
ctttataatctagatccacgcgtcagacaggaacttgaacaagaaatactcgagaatatt
gacaaagaygacgggattactgaagaagccctcaagaaaatgaatttaatggacagatat
ttactcgaggtgtttcgtatgtctcctccagtacctgttatcttcgggagagcgagaaaa
gatttcctgatggattcgggttctggaagcgtacaagtcaaaaccggtgagctcctgatt
gggaactgttatctcgttcatagagacccttctgttttccacaagccagatgaattcatg
ccatcgagatttgaagatgagagtcttcttgaccacatagtgttttctaatggtccgtat
cgtgaggcagccacacctaagaaccatcactgtccaggcaaggagattatcttcatgatt
ctgaaaagtgtattgatccaagtcatgatgtgttgtgattatacctttacggaaagacct
tactggacagagaaaagattaagaagacttggttgccccgacaacaacatggaattaagt
agttttacatacacaccgaaaagccccattatcaaggttcatcttcttgaagttgaagac
tttgatggtaaatag

DBGET integrated database retrieval system