KEGG   Agrobacterium fabacearum Ach5: Ach5_35980
Entry
Ach5_35980        CDS       T03816                                 

Name
(GenBank) lysine transporter LysE
  KO
K16327  putative LysE/RhtB family amino acid efflux pump
Organism
atf  Agrobacterium fabacearum Ach5
Brite
KEGG Orthology (KO) [BR:atf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:atf02000]
    Ach5_35980
Transporters [BR:atf02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   Ach5_35980
SSDB
Motif
Pfam: LysE MarC DPM3 DUF373 TerC Keratin_assoc LptF_LptG
Other DBs
NCBI-ProteinID: AKC09371
UniProt: F0LCV9
Position
linear:983227..983856
AA seq 209 aa
MELMLVLKSIVLGLAVAAPLGPIGALCINRTLERGFWAGVAGGLGTALADAVYASLAALG
FSAFAATLATIDTPLKIVGGLFMLWLGWKSLRPKPLAEAAKVGARDLLGTITATFFLTIT
NPMTILSFAAIFAGLGLADASGATSAFFVVAGVFLGSLLWWFMLSGGVAFARQRLPTTFA
RWVSRLSGVILVLFGLFALGSLAWGMMAH
NT seq 630 nt   +upstreamnt  +downstreamnt
atggaactgatgctcgttttgaaaagcattgtgctgggccttgcggtcgcagccccgctc
ggccccatcggcgccctctgcatcaaccggacccttgagcgcgggttctgggcgggagtg
gcaggtggccttgggactgctctggcggatgccgtgtatgccagcctcgcagcgctcggc
ttttccgctttcgcggcaacccttgcgacaatcgatacgccgctcaaaatcgtcggcggc
cttttcatgctgtggctcggctggaaaagcctgaggcccaaacctctggcagaagcggcc
aaggttggagcgcgcgatctgctcggcaccatcaccgcgacctttttcctgacgatcacc
aaccccatgacgatactgtcctttgcagcaattttcgcgggtctcggccttgctgacgca
tcgggagcgacgagcgcgttttttgtggtcgcgggcgtttttctagggtctttattgtgg
tggttcatgttgagcggcggcgttgcatttgcccggcagcgccttcccaccacctttgcc
cgctgggtttcccgcctgtccggagtgatccttgtcttattcgggctttttgccctaggt
tcacttgcctggggcatgatggctcattga

DBGET integrated database retrieval system