KEGG   Arabidopsis thaliana (thale cress): AT1G01210
Entry
AT1G01210         CDS       T00041                                 
Name
(RefSeq) DNA-directed RNA polymerase, subunit M, archaeal
  KO
K03019  DNA-directed RNA polymerase III subunit RPC11
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT1G01210
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT1G01210
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     AT1G01210
SSDB
Motif
Pfam: TFIIS_C RNA_POL_M_15KD Zn_Tnp_IS1595 Nudix_N_2 OrfB_Zn_ribbon YacG zf-ribbon_3 Lar_restr_allev FdhE DZR Baculo_LEF5_C zinc-ribbons_6 GpA_ATPase
Other DBs
NCBI-GeneID: 839481
NCBI-ProteinID: NP_001322609
TAIR: AT1G01210
UniProt: A0A384LJI7 Q9LNK0
Position
1:88622..90502
AA seq 106 aa
MEFCPTCGNLLRYEGGGNSRFFCSTCPYVAYIQRQVEIKKKQLLVKKSIEAVVTKDDIPT
AAETEAPCPRCGHDKAYFKSMQIRSADEPESRFYRCLKCEFTWREE
NT seq 321 nt   +upstreamnt  +downstreamnt
atggagttttgtccaacatgtgggaatctgttgcgatacgagggaggtggcaattcgaga
ttcttctgttccacatgtccatacgtcgcctacatccaaagacaggtggagataaagaag
aagcaacttctggttaagaaatctatagaagctgttgtgactaaagatgatatacccaca
gctgctgaaactgaagccccatgtccaaggtgtggccacgacaaggcatacttcaaatca
atgcagattcgttcagcagatgagccagaatcaagattttatagatgcttgaagtgcgag
ttcacttggcgtgaggaatga

KEGG   Arabidopsis thaliana (thale cress): AT4G07950
Entry
AT4G07950         CDS       T00041                                 
Name
(RefSeq) DNA-directed RNA polymerase, subunit M, archaeal
  KO
K03019  DNA-directed RNA polymerase III subunit RPC11
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT4G07950
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT4G07950
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     AT4G07950
SSDB
Motif
Pfam: TFIIS_C RNA_POL_M_15KD Zn_Tnp_IS1595 OrfB_Zn_ribbon Nudix_N_2 DZR YacG zf-ribbon_3 Lar_restr_allev zinc-ribbons_6 FdhE Baculo_LEF5_C DUF6758 GpA_ATPase DpnI
Other DBs
NCBI-GeneID: 826299
NCBI-ProteinID: NP_192535
TAIR: AT4G07950
UniProt: Q9ZQC0 A0A654FM67
Position
4:4797841..4799795
AA seq 106 aa
MEFCPTCGNLLRYEGGGSSRFFCSTCPYVANIERRVEIKKKQLLVKKSIEPVVTKDDIPT
AAETEAPCPRCGHDKAYFKSMQIRSADEPESRFYRCLKCEFTWREE
NT seq 321 nt   +upstreamnt  +downstreamnt
atggagttttgtcccacatgtgggaatctgttgcgctacgagggaggtgggagttcgaga
ttcttctgttccacatgtccatacgttgccaatatcgaaagacgggttgagataaagaag
aagcaacttctggttaagaaatctatagaacctgttgttactaaagatgatatacccaca
gctgctgaaacagaagctccatgtccaaggtgtggccacgacaaggcgtacttcaaatca
atgcagattcgttcagcagatgagccagaatcaagattttatagatgcttgaagtgcgag
ttcacttggcgtgaggaatga

DBGET integrated database retrieval system