KEGG   Arabidopsis thaliana (thale cress): AT1G06790
Entry
AT1G06790         CDS       T00041                                 
Name
(RefSeq) RNA polymerase Rpb7 N-terminal domain-containing protein
  KO
K03022  DNA-directed RNA polymerase III subunit RPC8
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT1G06790
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT1G06790
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     AT1G06790
SSDB
Motif
Pfam: RNA_pol_Rbc25 SHS2_Rpb7-N
Other DBs
NCBI-GeneID: 837190
NCBI-ProteinID: NP_172164
TAIR: AT1G06790
UniProt: A0A178WGX6 Q9M9Y6
Position
1:2087182..2089786
AA seq 204 aa
MFYLSELEHSLRVPPHLLNLPLEDAIKSVLQNVFLDKVLADLGLCVSIYDIKSVEGGFVL
PGDGAATYKVGLRIVVFRPFVGEVIAAKFKESDANGLRLTLGFFDDIYVPAPLMPKPNRC
EPDPYNRKQMIWVWEYGEPKEDYIVDDACQIKFRVESISYPSVPTERAEDAKPFAPMVVT
GNMDDDGLGPVSWWDSYEQVDQEE
NT seq 615 nt   +upstreamnt  +downstreamnt
atgttttatcttagcgagctagaacattcactaagagtgcctccgcatctacttaatctc
cctctcgaagatgccattaagtcagtgcttcaaaatgtgttcttggacaaggttttagct
gatttggggctttgtgtatctatttacgacattaaatcagtagaaggagggtttgtgtta
cccggtgatggtgctgcgacctataaggtaggtcttagaattgttgtgttccgtccattt
gttggtgaggtcatagctgcaaagttcaaagaatctgacgccaatggcttgcgcttaaca
cttggattctttgacgatatttatgtgcctgctccacttatgccgaaacccaaccgctgt
gagcctgacccttataataggaagcaaatgatatgggtgtgggaatatggagaaccgaaa
gaagactatattgttgacgatgcctgtcagatcaagtttcgagtagagagcatcagctat
ccatcagttccaactgagcgagcagaggacgcaaagccttttgctccaatggtggtcact
gggaatatggatgatgatggtttgggtcctgtttcttggtgggattcttatgaacaggtt
gatcaagaagagtga

DBGET integrated database retrieval system