KEGG   Arabidopsis thaliana (thale cress): AT1G07370
Entry
AT1G07370         CDS       T00041                                 
Symbol
PCNA1
Name
(RefSeq) proliferating cellular nuclear antigen 1
  KO
K04802  proliferating cell nuclear antigen
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03030  DNA replication
ath03410  Base excision repair
ath03420  Nucleotide excision repair
ath03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AT1G07370 (PCNA1)
   03410 Base excision repair
    AT1G07370 (PCNA1)
   03420 Nucleotide excision repair
    AT1G07370 (PCNA1)
   03430 Mismatch repair
    AT1G07370 (PCNA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ath03032]
    AT1G07370 (PCNA1)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT1G07370 (PCNA1)
DNA replication proteins [BR:ath03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    AT1G07370 (PCNA1)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     AT1G07370 (PCNA1)
   MMR (mismatch excision repair)
    Other MMR factors
     AT1G07370 (PCNA1)
  TLS (translesion DNA synthesis) factors
   Other TLS factors
    AT1G07370 (PCNA1)
SSDB
Motif
Pfam: PCNA_C PCNA_N Rad9 Porin_OmpL1
Other DBs
NCBI-GeneID: 837249
NCBI-ProteinID: NP_172217
TAIR: AT1G07370
UniProt: Q9M7Q7 A0A178W9N0 A0A6B7JDQ1
Structure
Position
1:2263037..2264553
AA seq 263 aa
MLELRLVQGSLLKKVLESIKDLVNDANFDCSSTGFSLQAMDSSHVALVSLLLRSEGFEHY
RCDRNLSMGMNLGNMSKMLKCAGNDDIITIKADDGGDTVTFMFESPTQDKIADFEMKLMD
IDSEHLGIPDAEYHSIVRMPSNEFSRICKDLSSIGDTVVISVTKEGVKFSTAGDIGTANI
VLRQNTTVDKPEDAIVIEMKEPVSLSFALRYMNSFTKATPLSDTVTISLSSELPVVVEYK
VAEMGYIRYYLAPKIEEEEDTNP
NT seq 792 nt   +upstreamnt  +downstreamnt
atgttggagctacgtcttgttcagggctcgttgttgaagaaggttctagaatcaatcaaa
gatctggtgaacgatgcgaatttcgactgctccagcactgggttctcactccaagctatg
gattcgagtcacgttgctctggtgtctctcttgctaagatccgaaggcttcgaacactac
agatgcgacaggaatctctccatggggatgaatctcggcaacatgtcgaagatgctcaaa
tgcgccggaaatgatgacatcatcaccatcaaggctgatgacggcggcgacaccgttacc
ttcatgtttgagagccccacgcaagacaagattgctgattttgagatgaagttgatggat
atagacagtgaacatctgggaatacctgatgctgagtaccactcaatcgtgaggatgcct
tccaatgagttttccaggatttgcaaagatctcagtagcattggtgacacagttgtgatc
tctgtgactaaagaaggcgtgaagttttctactgccggtgacattggaaccgctaacatt
gtgctcaggcagaacacaactgtagacaagccggaagatgcaattgtgatagagatgaag
gagccagtgtctctctcatttgccctgaggtacatgaattccttcacaaaggcaactcca
ttgtcagacacagtgacaatcagcttatcgtcggagttgccagtggttgtggagtataag
gttgctgagatgggttacattcgttactacttggctcctaagattgaagaagaagaagac
actaatccctaa

KEGG   Arabidopsis thaliana (thale cress): AT2G29570
Entry
AT2G29570         CDS       T00041                                 
Symbol
PCNA2
Name
(RefSeq) proliferating cell nuclear antigen 2
  KO
K04802  proliferating cell nuclear antigen
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03030  DNA replication
ath03410  Base excision repair
ath03420  Nucleotide excision repair
ath03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AT2G29570 (PCNA2)
   03410 Base excision repair
    AT2G29570 (PCNA2)
   03420 Nucleotide excision repair
    AT2G29570 (PCNA2)
   03430 Mismatch repair
    AT2G29570 (PCNA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ath03032]
    AT2G29570 (PCNA2)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT2G29570 (PCNA2)
DNA replication proteins [BR:ath03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    AT2G29570 (PCNA2)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     AT2G29570 (PCNA2)
   MMR (mismatch excision repair)
    Other MMR factors
     AT2G29570 (PCNA2)
  TLS (translesion DNA synthesis) factors
   Other TLS factors
    AT2G29570 (PCNA2)
SSDB
Motif
Pfam: PCNA_C PCNA_N Rad9 Porin_OmpL1
Other DBs
NCBI-GeneID: 817506
NCBI-ProteinID: NP_180517
TAIR: AT2G29570
UniProt: Q9ZW35 A0A178VSR5 A0A6B7JDQ4
Structure
Position
2:complement(12649906..12651753)
AA seq 264 aa
MLELRLVQGSLLKKVLEAVKDLVNDANFDCSTTGFSLQAMDSSHVALVSLLLRSEGFEHY
RCDRNLSMGMNLGNMSKMLKCAGNDDIITIKADDGSDTVTFMFESPTQDKIADFEMKLMD
IDSEHLGIPDAEYHSIVRMPSGEFSRICKDLSSIGDTVVISVTKEGVKFSTAGDIGTANI
VLRQNTTVDKPEDAIVIEMNEPVSLSFALRYMNSFTKATPLSETVTISLSSELPVVVEYK
VAEMGYIRYYLAPKIEEEEDTKPE
NT seq 795 nt   +upstreamnt  +downstreamnt
atgttggagcttcgtttagttcaaggttctctactgaagaaggttctagaagcggtcaaa
gatctggtgaacgatgcgaacttcgactgttcgaccacagggttctcgcttcaagctatg
gattcgagccatgtcgcgttggtgtctcttttgcttagatctgaaggtttcgagcactat
agatgcgataggaacctctctatgggaatgaatcttggtaatatgtctaagatgctgaaa
tgtgctggaaatgatgatatcatcaccatcaaagctgatgatggtagcgacactgttact
ttcatgtttgagagtcccacacaagacaagattgcagattttgagatgaagctgatggat
atcgacagtgagcatttaggaattcctgatgctgagtaccactcgattgtgagaatgcct
tctggtgaattttccaggatatgcaaagatctcagtagcattggtgacacagttgtgatc
tcggtaacaaaagaaggggtgaagttttcaacagcaggtgatatcgggacagcaaacatt
gtgctcaggcagaatactaccgtcgacaaacctgaagatgctattgtgatagagatgaac
gagcctgtttcgctttcatttgcattgaggtacatgaactccttcacaaaggctactcca
ttgtcggaaactgtgaccatcagtttgtcctctgagttaccggtcgtggtggagtacaag
gtggctgagatgggttacattcgatactatctggcgcctaagattgaagaagaagaagac
accaaaccagaataa

DBGET integrated database retrieval system