KEGG   Arabidopsis thaliana (thale cress): AT1G09815
Entry
AT1G09815         CDS       T00041                                 
Symbol
POLD4
Name
(RefSeq) polymerase delta 4
  KO
K03505  DNA polymerase delta subunit 4
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03030  DNA replication
ath03410  Base excision repair
ath03420  Nucleotide excision repair
ath03430  Mismatch repair
ath03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AT1G09815 (POLD4)
   03410 Base excision repair
    AT1G09815 (POLD4)
   03420 Nucleotide excision repair
    AT1G09815 (POLD4)
   03430 Mismatch repair
    AT1G09815 (POLD4)
   03440 Homologous recombination
    AT1G09815 (POLD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ath03032]
    AT1G09815 (POLD4)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT1G09815 (POLD4)
DNA replication proteins [BR:ath03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    AT1G09815 (POLD4)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      AT1G09815 (POLD4)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     AT1G09815 (POLD4)
SSDB
Motif
Pfam: DNA_pol_delta_4
Other DBs
NCBI-GeneID: 837513
NCBI-ProteinID: NP_563854
TAIR: AT1G09815
UniProt: A0A178WHS7 Q1H568
Position
1:3189301..3190242
AA seq 124 aa
MATTAKNLKGFYKQTKSNITGGISKSKPSSRKVAPKHAAAQGSDVTQPAALISHGSVDLN
EDYDKEEEMLRQFDMNITYGPCLGMTRLDRWERAVRLGMNPPNEIEKLLKTGKVQQDCLW
QGRV
NT seq 375 nt   +upstreamnt  +downstreamnt
atggcgacgacggcgaagaatttgaagggtttctacaagcagactaaaagcaatatcacc
ggaggtatctccaagtccaagccttcttcccggaaagtggctcccaaacacgcggcggct
caaggttctgatgttacccagcccgccgcattgatttcacacggctccgtcgatctcaac
gaggattatgacaaggaggaggagatgcttagacaatttgacatgaacatcacttatggt
ccgtgcctgggtatgacgagacttgatcgatgggagcgtgcagtgcgtcttgggatgaac
cctcccaatgaaatcgagaagcttttgaagaccgggaaagtccagcaagattgtctgtgg
caaggtcgtgtctag

KEGG   Arabidopsis thaliana (thale cress): AT1G78650
Entry
AT1G78650         CDS       T00041                                 
Symbol
POLD3
Name
(RefSeq) DNA-directed DNA polymerase
  KO
K03504  DNA polymerase delta subunit 3
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03030  DNA replication
ath03410  Base excision repair
ath03420  Nucleotide excision repair
ath03430  Mismatch repair
ath03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AT1G78650 (POLD3)
   03410 Base excision repair
    AT1G78650 (POLD3)
   03420 Nucleotide excision repair
    AT1G78650 (POLD3)
   03430 Mismatch repair
    AT1G78650 (POLD3)
   03440 Homologous recombination
    AT1G78650 (POLD3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ath01009]
    AT1G78650 (POLD3)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ath03032]
    AT1G78650 (POLD3)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT1G78650 (POLD3)
Protein phosphatases and associated proteins [BR:ath01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AT1G78650 (POLD3)
DNA replication proteins [BR:ath03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    AT1G78650 (POLD3)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      AT1G78650 (POLD3)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     AT1G78650 (POLD3)
SSDB
Motif
Pfam: CDC27
Other DBs
NCBI-GeneID: 844201
NCBI-ProteinID: NP_565185
TAIR: AT1G78650
UniProt: Q9SYL7 A0A654ERR9
Position
1:29582907..29585665
AA seq 509 aa
MTHTETLNLLDEIESFVSDQLQVVSYKWLSRNFSLSSNTAKRLLKDFVEKHGKGLEVVYI
VSGLLKNGPSDYHARLASSTELPEVEKEFNGKYSVHIYSVQASIPMDPAAIWNTEFVQAE
ELFRQPSATDNCLKGNRFCGVSNSCVKRNIEGATENVTAPRTESVRTTGQSKSSSNFQKS
TVPSNQGKNFQHSSSNVGHQAKSESIAAPAKNQSAKSSLDKEKAFHVPANKKNGQGEKSV
TGTGGLLKNMWGRVPVKTEDDSPTVDVKNHITNHSEPQKPSHDADKKGGSDDETRDANFM
RAPKDNRKRKVIFDFSDDEYEDVISLASPSSPKVNSRPDVELSSEDSGPEKPDADVSPEI
KSEEPEASKEDRQNTASVDASTTLSTEKIQAIGSEAEVNPSKRRTTAVPSSPKRKKVLKS
RIDDRGREVTEVVWEETETNAKKKEDTNTSKKLDDGKTANAVNRAVAQKKSPAIGNTAAT
NAGGKAGSKKGGNVKDPKQGNIMSFFKKV
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgacccacaccgaaaccctaaatctgctcgatgaaatcgagtcttttgtctccgatcag
cttcaagtggtatcttacaaatggctgagtcgaaatttctcgctttcatcaaatacggcc
aagaggttgctcaaggattttgtagagaaacatgggaagggtttggaagttgtatatatt
gtgtccggattgctaaagaacggaccttccgattaccacgcaaggcttgcttctagtacc
gaacttccagaagtagagaaagagttcaatggaaaatattcagtacatatctacagtgtt
caagctagtattccaatggatccagcagccatatggaacactgagtttgtacaagcagaa
gaactcttcaggcagccttctgccactgataattgtttgaaaggcaacaggttttgtggc
gtctccaattcttgtgtgaagcgcaatatagagggagccactgaaaatgttaccgccccg
cgaactgaaagtgtgagaactacaggacaatctaaaagtagttcaaattttcaaaagagt
acagtgccgtcaaaccagggaaagaatttccagcactcaagctctaatgttggccatcag
gctaagagtgaatctattgctgctccagctaaaaatcagtctgcgaaatcctctttggat
aaagaaaaagcttttcatgtgcccgctaataaaaagaatggacagggcgagaagagcgtg
actggaactggtggtttgttgaaaaatatgtggggccgtgtgcctgtgaaaacagaagat
gattctccaacagtagatgtgaaaaatcatattactaatcattcggaaccccaaaaacct
tctcatgatgctgacaagaagggaggcagcgatgatgagactcgagacgccaatttcatg
agagcgcctaaagataacagaaaaagaaaggtgatatttgatttttcagatgacgagtat
gaagatgtaatcagcttagcatctcctagtagtccaaaggttaattcacgtccagatgtc
gaactcagttcggaagattcaggtccagagaagcctgacgcagatgtttctccagagata
aaatctgaggaaccagaggccagcaaagaagacaggcaaaacactgcttctgttgatgct
tctacgactttgtcaacggagaagatccaggccattggttctgaagctgaagtgaatccc
tcaaagagaagaactactgcagttcctagttcgccgaaaaggaaaaaggtgttgaagtca
cggattgatgatcgtgggagagaagtaactgaggtagtgtgggaggagacagaaacgaac
gcaaagaagaaagaggacactaatacaagtaagaagttagatgatggcaaaaccgcaaat
gctgttaacagggcggttgcacagaagaagagtccggccattggaaacacagcagcgaca
aacgcaggaggaaaagcgggaagcaagaaaggaggaaacgtcaaagatccaaagcaaggg
aatataatgtccttcttcaagaaagtttaa

KEGG   Arabidopsis thaliana (thale cress): AT2G42120
Entry
AT2G42120         CDS       T00041                                 
Symbol
POLD2
Name
(RefSeq) DNA polymerase delta small subunit
  KO
K02328  DNA polymerase delta subunit 2
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03030  DNA replication
ath03410  Base excision repair
ath03420  Nucleotide excision repair
ath03430  Mismatch repair
ath03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AT2G42120 (POLD2)
   03410 Base excision repair
    AT2G42120 (POLD2)
   03420 Nucleotide excision repair
    AT2G42120 (POLD2)
   03430 Mismatch repair
    AT2G42120 (POLD2)
   03440 Homologous recombination
    AT2G42120 (POLD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ath03032]
    AT2G42120 (POLD2)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT2G42120 (POLD2)
DNA replication proteins [BR:ath03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    AT2G42120 (POLD2)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      AT2G42120 (POLD2)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     AT2G42120 (POLD2)
SSDB
Motif
Pfam: DNA_pol_E_B DNA_pol_D_N
Other DBs
NCBI-GeneID: 818812
NCBI-ProteinID: NP_973664
TAIR: AT2G42120
UniProt: O48520
Position
2:complement(17563133..17566237)
AA seq 440 aa
MEIDSEKIHERKQSDYNSLDERFEIQKEMYRGQQYSQIYFARLHLMRTLLYSLAPTWKSH
LPVCKVLGLEKGKECIIVGTLFKHMKLKPCVLDEYSKERSVTPLVKPHNFMHPDDNLILE
DESGRVKLAGSALSPAIYVTGVVVALHGKETNAGEFFVEDVLEAGLPPQIERPIDLQEDK
YVVLLSGLCIGSKSANPLQFQLLVDHITGHLGDEEEQGLAAQIVHVVIAGNSFEFPRKLI
NGQNLASKDQSTLYEPIKELDIMLSQIAAGVSVDIMPGTNDPANFALPQQPLNRCLFPGS
SPYNTFRSCTNPHSFDVDNIRFLGTSGQNIDDLGKYSEAKSKLDFVERTLRWRHLAPTAP
NTLGCYPFTDRDPFLIETCPHVYFVGNQDKYDNRLIKGSEGQLVRLICIPKFCETGIAVA
VNLRNLECHTLSFSTQINQS
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggaaatcgactccgagaaaattcacgaaaggaagcaatccgattacaattcgctggat
gagagattcgagatacagaaggagatgtacagaggtcagcaatacagtcagatttacttt
gctcgtcttcatctcatgagaacacttctctactctcttgctcctacttggaaatctcat
ttgcctgtgtgtaaggttttgggacttgaaaaaggaaaagaatgcataattgtgggaacc
ttgttcaaacacatgaagcttaaaccttgtgttctcgatgaatattctaaagagaggtca
gttactccgcttgttaaaccacataactttatgcatcctgatgataatctgatcctcgaa
gacgagagtgggagagttaagcttgctggttccgcactttcacctgcgatttatgtgaca
ggtgttgttgttgcactgcatgggaaggaaactaatgctggtgaattctttgttgaggat
gtactagaagctggtttaccacctcagattgagcggcctatcgatctacaggaagataaa
tatgtcgtgttattgtcgggcctttgtattggaagcaaatcggctaatcccctgcagttt
cagcttcttgttgaccatataactgggcatctcggagatgaggaggaacaaggccttgca
gcacagatagttcatgtagtaattgctggaaactcttttgaatttccccgcaaactcatt
aatggccagaacttggcctcgaaagatcaatcgacactgtatgagcccatcaaagagctt
gatatcatgttaagccagatagctgcaggagtttcagtagatatcatgccaggcacgaat
gatccagctaacttcgcattgcctcagcagcctctgaatagatgtcttttccctggatct
tcaccttataacaccttcagatcatgtacaaatcctcactcatttgatgtcgataatatc
agatttcttggaacttctggtcagaacatcgatgaccttggcaagtactcagaggctaag
agcaagcttgattttgtggaaagaacgctgaggtggagacatcttgccccaactgcacct
aatacactcggttgttatcctttcaccgatagagaccctttcttgattgaaacctgcccg
catgtctacttcgtcgggaatcaagataaatatgacaaccgtttgataaaggggtcagaa
gggcagcttgtccggttgatctgcattcctaagttctgtgagaccggtattgctgttgcg
gtgaacctaagaaatctggaatgtcacactttaagctttagcactcagataaaccaatca
taa

KEGG   Arabidopsis thaliana (thale cress): AT5G63960
Entry
AT5G63960         CDS       T00041                                 
Name
(RefSeq) DNA polymerase delta subunit 1
  KO
K02327  DNA polymerase delta subunit 1 [EC:2.7.7.7]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03030  DNA replication
ath03410  Base excision repair
ath03420  Nucleotide excision repair
ath03430  Mismatch repair
ath03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AT5G63960
   03410 Base excision repair
    AT5G63960
   03420 Nucleotide excision repair
    AT5G63960
   03430 Mismatch repair
    AT5G63960
   03440 Homologous recombination
    AT5G63960
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ath03032]
    AT5G63960
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT5G63960
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AT5G63960
DNA replication proteins [BR:ath03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    AT5G63960
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      AT5G63960
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     AT5G63960
SSDB
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 zf-C4pol DNA_pol_B_2 divDNApol
Other DBs
NCBI-GeneID: 836517
NCBI-ProteinID: NP_201201
TAIR: AT5G63960
UniProt: Q9LVN7 A0A178UA08
Position
5:25599514..25606841
AA seq 1095 aa
MNRSGISKKRPPPSNTPPPAGKHRATGDSTPSPAIGTLDDEFMMEEDVFLDETLLYGDED
EESLILRDIEERESRSSAWARPPLSPAYLSNSQSIIFQQLEIDSIIAESHKELLPGSSGQ
APIIRMFGVTREGNSVCCFVHGFEPYFYIACPPGMGPDDISNFHQSLEGRMRESNKNAKV
PKFVKRIEMVQKRSIMYYQQQKSQTFLKITVALPTMVASCRGILDRGLQIDGLGMKSFQT
YESNILFVLRFMVDCDIVGGNWIEVPTGKYKKNARTLSYCQLEFHCLYSDLISHAAEGEY
SKMAPFRVLSFDIECAGRKGHFPEAKHDPVIQIANLVTLQGEDHPFVRNVMTLKSCAPIV
GVDVMSFETEREVLLAWRDLIRDVDPDIIIGYNICKFDLPYLIERAATLGIEEFPLLGRV
KNSRVRVRDSTFSSRQQGIRESKETTIEGRFQFDLIQAIHRDHKLSSYSLNSVSAHFLSE
QKEDVHHSIITDLQNGNAETRRRLAVYCLKDAYLPQRLLDKLMFIYNYVEMARVTGVPIS
FLLARGQSIKVLSQLLRKGKQKNLVLPNAKQSGSEQGTYEGATVLEARTGFYEKPIATLD
FASLYPSIMMAYNLCYCTLVTPEDVRKLNLPPEHVTKTPSGETFVKQTLQKGILPEILEE
LLTARKRAKADLKEAKDPLEKAVLDGRQLALKISANSVYGFTGATVGQLPCLEISSSVTS
YGRQMIEQTKKLVEDKFTTLGGYQYNAEVIYGDTDSVMVQFGVSDVEAAMTLGREAAEHI
SGTFIKPIKLEFEKVYFPYLLINKKRYAGLLWTNPQQFDKMDTKGIETVRRDNCLLVKNL
VTESLNKILIDRDVPGAAENVKKTISDLLMNRIDLSLLVITKGLTKTGDDYEVKSAHGEL
AERMRKRDAATAPNVGDRVPYVIIKAAKGAKAYERSEDPIYVLQNNIPIDPNYYLENQIS
KPLLRIFEPVLKNASKELLHGSHTRSISITTPSNSGIMKFAKKQLSCVGCKVPISNGTLC
ASCKGREAELYCKNVSQVAELEEVFGRLWTQCQECQGSLHQDVLCTSRDCPIFYRRMKAQ
KDMAVARQQLDRWSF
NT seq 3288 nt   +upstreamnt  +downstreamnt
atgaatagatccggtatttccaaaaagcgaccgcctccttcgaataccccaccaccggcg
ggtaagcatcgagccactggtgattcaacaccatctccggccatcggaaccctagatgat
gaatttatgatggaagaggacgtgtttctggacgaaactctcttgtacggcgacgaagat
gaggaatccctaatcctccgtgacattgaggagcgtgaatcgcgttcctcggcttgggct
cgacctccgctctcccccgcgtatctctcgaattcacagagtatcattttccaacaattg
gagattgactctataatcgcggagagtcataaggagctgttaccgggttcctcagggcaa
gctccaatcattaggatgtttggggttaccagagaaggtaacagtgtgtgttgctttgtt
catggatttgagccatacttttacattgcttgccctcctggaatggggccagacgatatt
tctaatttccatcagagtcttgagggaaggatgagggaatccaataaaaatgccaaggtc
ccgaaatttgttaaacgtatagaaatggtgcagaaaagaagcattatgtattaccaacag
caaaaatcccaaacttttctgaagattacagttgcattgccgactatggtggcaagctgt
cgcggcatccttgatagaggcctacaaattgatggattgggtatgaagagcttccagaca
tatgaaagcaatattcttttcgttctccgtttcatggttgattgtgatattgtcggagga
aattggattgaagtacctactgggaagtataagaaaaatgcaagaactttgtcatactgc
caattggagttccattgcctgtactcagatctaatcagtcatgctgcagaaggtgaatac
tcaaaaatggctccattccgtgtactaagtttcgatattgagtgtgcaggtcgtaaagga
cattttccggaagctaagcatgatcctgtaatccagatagcgaaccttgttactcttcag
ggagaggatcacccatttgtacgcaatgtcatgactcttaagtcatgtgctccaatcgta
ggcgtagatgtcatgtcttttgaaacagaaagagaggtcttactagcttggagggatttg
attcgtgatgttgatcctgatatcatcattggttataacatctgcaaattcgatttacct
tatctgattgagagagctgctacactgggaatagaggaatttcctcttcttggtcgtgta
aagaacagtagggtccgggtcagggactcaacattttcatcaagacaacaaggaataaga
gaaagtaaagagaccacaattgaaggaagatttcagtttgaccttattcaggcaatacac
agagaccacaaattaagttcttattcgctgaattctgtctcagctcactttctttccgag
cagaaagaagatgtccaccattctataataactgatctccagaatgggaatgcggaaacc
aggaggcgtcttgctgtttattgtttgaaggatgcatatcttcctcagaggcttctggac
aaactgatgtttatatataattatgtcgaaatggctcgtgtaactggtgtccctatttca
tttcttcttgcgagaggacagagtatcaaggttttatctcagcttcttaggaaaggcaaa
cagaaaaatctggttcttccaaatgctaaacagtcagggtccgaacaaggaacttatgaa
ggcgcaactgttttagaagcaagaacaggtttctatgaaaagccaattgcaactttggat
tttgcttcactgtacccgtcaattatgatggcatataatctgtgctactgcaccttggtg
acacctgaagatgtacgcaaactgaatcttccacctgaacatgtcactaaaactccatca
ggggaaacatttgttaagcaaactttgcaaaagggtatacttccagaaattctcgaagag
cttcttactgcccgtaagagagctaaagcagatttaaaggaggctaaggatccccttgag
aaggctgttttagatggtagacagttagcgttgaagatcagtgcaaattctgtctacggg
tttacgggagccactgttgggcagttaccatgcttagaaatatcctcgagtgtaactagc
tatggtcgtcagatgattgaacaaacaaagaaacttgttgaagacaaattcacaacactg
ggagggtatcaatacaatgcagaggtcatttatggagacacggattcagtcatggtgcaa
tttggagtatcggatgtagaagctgcgatgaccttggggagggaagctgcagaacacatt
agtggaacttttatcaaacccatcaaattggagtttgaaaaggtctatttcccatatctt
ctcattaacaagaagaggtatgctggtttgctatggacaaatcctcaacagtttgacaaa
atggacaccaaaggaatcgagacagtacgaagggataattgtttactggttaagaacctc
gtgactgagagtcttaacaaaatacttattgatagagatgttccaggggcagctgaaaat
gtcaagaaaaccatttcggatcttctcatgaaccgtattgacttgtcacttttggtgatt
actaagggtctaacgaaaacaggagatgattatgaagttaaatcagctcatggtgaactt
gctgaacgcatgcgtaagagggatgctgctacagcgccaaatgttggagatcgagtaccg
tatgttatcataaaagctgctaaaggtgccaaggcttatgaacgatcagaagatccaatc
tacgtgctacagaataatatccctatagacccaaattactacttggagaatcagattagc
aagccacttcttaggatttttgagccagtcctgaaaaatgctagcaaggagcttctccat
ggaagtcacacgaggtcaatatcaatcactactccttcaaacagcggtataatgaagttt
gctaaaaaacaactgagctgtgttggctgcaaagttccgatcagcaatggaacactatgc
gcaagttgcaagggaagagaagccgagttatattgcaaaaacgtgtctcaagtggctgag
cttgaagaggtttttgggaggctgtggacacagtgccaggagtgtcaaggctctcttcat
caagatgtcttgtgcaccagtcgagattgtccaatattttaccggagaatgaaagcacaa
aaagacatggctgtagccaggcaacaactcgaccgttggagcttctaa

DBGET integrated database retrieval system