KEGG   Arabidopsis thaliana (thale cress): AT1G10060
Entry
AT1G10060         CDS       T00041                                 
Symbol
BCAT-1
Name
(RefSeq) branched-chain amino acid transaminase 1
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00270  Cysteine and methionine metabolism
ath00280  Valine, leucine and isoleucine degradation
ath00290  Valine, leucine and isoleucine biosynthesis
ath00770  Pantothenate and CoA biosynthesis
ath00966  Glucosinolate biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01210  2-Oxocarboxylic acid metabolism
ath01230  Biosynthesis of amino acids
ath01240  Biosynthesis of cofactors
Module
ath_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
ath_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
ath_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AT1G10060 (BCAT-1)
   00280 Valine, leucine and isoleucine degradation
    AT1G10060 (BCAT-1)
   00290 Valine, leucine and isoleucine biosynthesis
    AT1G10060 (BCAT-1)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT1G10060 (BCAT-1)
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    AT1G10060 (BCAT-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ath01007]
    AT1G10060 (BCAT-1)
Enzymes [BR:ath01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     AT1G10060 (BCAT-1)
Amino acid related enzymes [BR:ath01007]
 Aminotransferase (transaminase)
  Class IV
   AT1G10060 (BCAT-1)
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 837542
NCBI-ProteinID: NP_849629
TAIR: AT1G10060
UniProt: Q93Y32 B9DFH1
Position
1:3284073..3287292
AA seq 384 aa
MALRRCLPQYSTTSSYLSKIWGFRMHGTKAAASVVEEHVSGAEREDEEYADVDWDNLGFS
LVRTDFMFATKSCRDGNFEQGYLSRYGNIELNPAAGILNYGQGLIEGMKAYRGEDGRVLL
FRPELNAMRMKIGAERMCMHSPSVHQFIEGVKQTVLANRRWVPPPGKGSLYLRPLLFGSG
ASLGVAAASEYTFLVFGSPVQNYFKEGTAALNLYVEEVIPRAYLGGTGGVKAISNYGPVL
EVMRRAKSRGFSDVLYLDADTGKNIEEVSAANIFLVKGNTIVTPATSGTILGGITRKSII
EIALDLGYKVEERSVPVEELKEAEEVFCTGTAAGVASVGSITFKNTRTEYKVGDGIVTQQ
LRSILVGIQTGSIQDTKDWVLQIA
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggctcttcgtcgctgcttacctcaatattcaacaacttcatcttatctctccaagatc
tggggatttcgtatgcatgggaccaaggcagcagcttctgttgtagaagaacatgtctcg
ggggcagaacgtgaggatgaagaatatgctgatgtagattgggacaaccttggattcagt
cttgtacggacagatttcatgttcgccaccaaaagttgcagagacggaaacttcgaacag
ggttaccttagccgttacggcaacatcgagctcaaccctgctgctggaattctcaactat
ggccagggactaatagaggggatgaaagcgtacagaggagaagacggtagggttcttctc
ttccgtccagagctaaacgcgatgcgtatgaagataggagctgagagaatgtgtatgcat
tctccttctgttcatcagtttattgaaggtgttaagcagaccgttcttgcaaacaggcgt
tgggttcctcctccgggcaaaggctcgttgtatctcagaccgttgttgttcggaagtgga
gcaagcttgggtgtggctgcagcatcagagtacacgtttcttgtgtttggctctcctgtt
caaaactacttcaaggaaggcacagcggcgttgaacctgtatgtggaggaggtgattcca
cgcgcttatcttggaggaactggtggtgtaaaggcaatatccaattacggtccagtgctt
gaagtgatgagaagagcaaaatcaagagggttttcggatgttttgtatcttgatgcagat
actgggaagaacatagaagaagtctctgctgctaatatattccttgtgaagggcaataca
atagtgacaccagctacgagcggaacgattctcggagggatcacacgtaagagcataatc
gaaatcgcccttgatcttggttacaaagtggaagaacgaagtgttccggtagaagaactg
aaggaagctgaagaagttttctgcactggaactgccgctggagttgcttctgttggaagc
atcacttttaagaacacaaggactgagtacaaagttggagatgggattgttacacagcaa
cttcgatctattcttgtcggaatacaaactggttctatccaagacactaaagattgggtt
ttgcagattgcctaa

KEGG   Arabidopsis thaliana (thale cress): AT1G10070
Entry
AT1G10070         CDS       T00041                                 
Symbol
BCAT-2
Name
(RefSeq) branched-chain amino acid transaminase 2
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00270  Cysteine and methionine metabolism
ath00280  Valine, leucine and isoleucine degradation
ath00290  Valine, leucine and isoleucine biosynthesis
ath00770  Pantothenate and CoA biosynthesis
ath00966  Glucosinolate biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01210  2-Oxocarboxylic acid metabolism
ath01230  Biosynthesis of amino acids
ath01240  Biosynthesis of cofactors
Module
ath_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
ath_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
ath_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AT1G10070 (BCAT-2)
   00280 Valine, leucine and isoleucine degradation
    AT1G10070 (BCAT-2)
   00290 Valine, leucine and isoleucine biosynthesis
    AT1G10070 (BCAT-2)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT1G10070 (BCAT-2)
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    AT1G10070 (BCAT-2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ath01007]
    AT1G10070 (BCAT-2)
Enzymes [BR:ath01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     AT1G10070 (BCAT-2)
Amino acid related enzymes [BR:ath01007]
 Aminotransferase (transaminase)
  Class IV
   AT1G10070 (BCAT-2)
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 837543
NCBI-ProteinID: NP_172478
TAIR: AT1G10070
UniProt: Q9M439 B9DHH5
Position
1:3288087..3290471
AA seq 388 aa
MIKTITSLRKTLVLPLHLHIRTLQTFAKYNAQAASALREERKKPLYQNGDDVYADLDWDN
LGFGLNPADYMYVMKCSKDGEFTQGELSPYGNIQLSPSAGVLNYGQAIYEGTKAYRKENG
KLLLFRPDHNAIRMKLGAERMLMPSPSVDQFVNAVKQTALANKRWVPPAGKGTLYIRPLL
MGSGPILGLGPAPEYTFIVYASPVGNYFKEGMAALNLYVEEEYVRAAPGGAGGVKSITNY
APVLKALSRAKSRGFSDVLYLDSVKKKYLEEASSCNVFVVKGRTISTPATNGTILEGITR
KSVMEIASDQGYQVVEKAVHVDEVMDADEVFCTGTAVVVAPVGTITYQEKRVEYKTGDES
VCQKLRSVLVGIQTGLIEDNKGWVTDIN
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgatcaaaacaatcacatctctacgcaaaactctggttctacctcttcatttacatatt
cgtacgctacaaactttcgccaagtacaacgcacaagctgcatcggctttgcgagaagag
cgtaagaaacctctttatcaaaatggagatgatgtatatgcggatttggattgggataat
ctcgggtttggtctaaatccagctgattacatgtatgtcatgaaatgctcaaaagacggc
gaattcactcaaggagaacttagtccctatgggaatattcagctaagtccttctgctgga
gtcttaaactatggacaggcgatatacgaaggtacaaaagcatacaggaaagaaaatggg
aagcttcttttgtttcgtccggatcacaacgctatccggatgaagcttggcgctgaacgg
atgctcatgccttctccttcggttgatcagtttgttaatgcagttaaacaaaccgctctt
gcaaacaaacgttgggttcctcctgcagggaaagggactttgtacattaggcctttgttg
atgggaagtggtccaatacttggtttaggtcctgcacctgaatatacattcattgtctat
gcatctccagttggtaactacttcaaggaagggatggctgctcttaacctctatgttgag
gaagaatatgtccgagcggctcctggtggagctggaggcgtcaagagcatcacaaattat
gcgccagttttgaaagcactgagcagagccaagagtcgggggttttcagacgttctttat
ctcgactctgtcaagaagaagtacttagaggaggcttcttcttgcaacgtctttgttgtc
aagggtcggacaatctcaactcctgcaactaatggaacaattcttgaagggattacgcgg
aaaagtgtgatggagatcgcaagtgatcaaggttatcaggtagtagagaaggcagttcat
gtggatgaagtaatggatgcagatgaagttttttgcaccggaactgctgtagtagttgct
cccgtgggcactatcacatatcaggaaaaaagagtagagtataaaaccggggatgaatct
gtctgccagaaactgcgttcagtcctcgtaggtatccagacaggattgattgaagataac
aagggatgggtcacagatatcaactga

KEGG   Arabidopsis thaliana (thale cress): AT1G50090
Entry
AT1G50090         CDS       T00041                                 
Symbol
BCAT7
Name
(RefSeq) D-aminoacid aminotransferase-like PLP-dependent enzymes superfamily protein
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00270  Cysteine and methionine metabolism
ath00280  Valine, leucine and isoleucine degradation
ath00290  Valine, leucine and isoleucine biosynthesis
ath00770  Pantothenate and CoA biosynthesis
ath00966  Glucosinolate biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01210  2-Oxocarboxylic acid metabolism
ath01230  Biosynthesis of amino acids
ath01240  Biosynthesis of cofactors
Module
ath_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
ath_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
ath_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AT1G50090 (BCAT7)
   00280 Valine, leucine and isoleucine degradation
    AT1G50090 (BCAT7)
   00290 Valine, leucine and isoleucine biosynthesis
    AT1G50090 (BCAT7)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT1G50090 (BCAT7)
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    AT1G50090 (BCAT7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ath01007]
    AT1G50090 (BCAT7)
Enzymes [BR:ath01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     AT1G50090 (BCAT7)
Amino acid related enzymes [BR:ath01007]
 Aminotransferase (transaminase)
  Class IV
   AT1G50090 (BCAT7)
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 841432
NCBI-ProteinID: NP_175430
TAIR: AT1G50090
UniProt: Q9LPM8
Position
1:complement(18554564..18556826)
AA seq 367 aa
MAPSVHPSSSPLFTSKADEKYANVKWDELGFALVPTDYMYVAKCKQGESFSTGEIVPYGD
ISISPCAGILNYGQGLFEGLKAYRTEDGRITLFRPDQNAIRMQTGADRLCMTPPSPEQFV
EAVKQTVLANNKWVPPPGKGALYIRPLLIGTGAVLGVASAPEYTFLIYTSPVGNYHKASS
GLNLKVDHNHRRAHFGGTGGVKSCTNYSPVVKSLIEAKSSGFSDVLFLDAATGKNIEEVS
TCNIFILKGNIVSTPPTSGTILPGITRKSICELARDIGYEVQERDLSVDELLEAEEVFCT
GTAVVIKAVETVTFHDKRVKYRTGEEAFSTKLHLILTNIQMGVVEDKKGWMMEIDHLVGT
DSFPDET
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggctccttctgtgcacccttcttcatcacctctttttacaagtaaagccgatgaaaag
tatgcgaatgtaaaatgggatgagctcggattcgcactggttccaacagattatatgtat
gtggcgaaatgcaaacaaggagagagcttttcaacaggagagattgttccttatggggat
atttctataagcccttgtgctgggattctcaattatggccagggactatttgaaggtctc
aaggcttacaggacagaagacggtcggatcacactcttccgacctgaccaaaacgctatt
cgtatgcaaacaggtgcagataggctttgtatgacacctccttccccggagcaattcgtt
gaagcagttaagcaaactgtgcttgccaacaacaaatgggtacctcctccggggaaagga
gctttgtatattaggcctctactcataggtactggtgctgtccttggagtagcttcagct
cctgaatatacgttcctcatttacacatctcccgtgggaaattatcacaaggcaagctca
ggcttgaacctcaaagttgatcataaccatcgccgagcccacttcggtggaacagggggt
gtgaagagctgcacaaattattctccagttgtaaaatcgttgatcgaagcaaagtcttcg
ggtttctctgatgtcttgttcctggatgcggcaactggtaaaaacatcgaagaggtttct
acttgtaacatcttcattctaaagggaaacattgtatccactcccccaacttcaggaacc
attttaccaggaatcacaaggaagagcatatgtgagctagcccgtgacattggctatgag
gttcaagaacgtgatctttctgtggatgagctattagaggcagaggaagttttttgcacg
gggacggcagtggtcattaaagctgttgaaaccgtgacattccatgacaaaagggtaaaa
tatagaacaggagaagaagcattctctacgaagcttcacttgatattaactaatattcaa
atgggagttgtcgaagataagaagggttggatgatggagatcgatcatttggttggaaca
gattcgtttcctgatgaaacataa

KEGG   Arabidopsis thaliana (thale cress): AT1G50110
Entry
AT1G50110         CDS       T00041                                 
Name
(RefSeq) D-aminoacid aminotransferase-like PLP-dependent enzymes superfamily protein
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00270  Cysteine and methionine metabolism
ath00280  Valine, leucine and isoleucine degradation
ath00290  Valine, leucine and isoleucine biosynthesis
ath00770  Pantothenate and CoA biosynthesis
ath00966  Glucosinolate biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01210  2-Oxocarboxylic acid metabolism
ath01230  Biosynthesis of amino acids
ath01240  Biosynthesis of cofactors
Module
ath_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
ath_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
ath_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AT1G50110
   00280 Valine, leucine and isoleucine degradation
    AT1G50110
   00290 Valine, leucine and isoleucine biosynthesis
    AT1G50110
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT1G50110
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    AT1G50110
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ath01007]
    AT1G50110
Enzymes [BR:ath01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     AT1G50110
Amino acid related enzymes [BR:ath01007]
 Aminotransferase (transaminase)
  Class IV
   AT1G50110
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 841433
NCBI-ProteinID: NP_175431
TAIR: AT1G50110
UniProt: Q9LPM9 A0A178WB05
Position
1:complement(18557984..18560391)
AA seq 356 aa
MAPSSSPLRTTSETDEKYANVKWEELGFALTPIDYMYVAKCRQGESFTQGKIVPYGDISI
SPCSPILNYGQGLFEGLKAYRTEDDRIRIFRPDQNALRMQTGAERLCMTPPTLEQFVEAV
KQTVLANKKWVPPPGKGTLYIRPLLLGSGATLGVAPAPEYTFLIYASPVGDYHKVSSGLN
LKVDHKYHRAHSGGTGGVKSCTNYSPVVKSLLEAKSAGFSDVLFLDAATGRNIEELTACN
IFIVKGNIVSTPPTSGTILPGVTRKSISELAHDIGYQVEERDVSVDELLEAEEVFCTGTA
VVVKAVETVTFHDKKVKYRTGEAALSTKLHSMLTNIQMGVVEDKKGWMVDIDPCQG
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggctccttcttcatcacctcttcgtactacaagtgaaacagatgaaaaatatgcgaat
gtcaaatgggaagagcttggattcgctctgactccaatagattatatgtatgtagccaaa
tgcagacaaggagagagctttacacaagggaagattgttccttatggcgacatttcaatt
agcccttgttctccgattctcaattacggccagggactatttgaaggtctcaaagcttac
agaacagaagacgaccggattaggattttccggcctgaccaaaacgctcttcgcatgcaa
actggtgcggagaggctttgtatgacacctcctactctagaacaatttgtcgaggcagtt
aagcaaactgtgcttgccaacaagaaatgggttcctcctccgggtaaaggaactctgtat
ataaggcctctgctactagggagtggtgctacccttggagtagctccagcacctgaatac
acttttctcatatatgcatctcccgtaggagattaccataaggtaagctcaggcttgaac
ctcaaagttgatcataagtatcaccgagcccattcaggtggaacggggggtgtcaagagc
tgcacaaactattctccagttgtgaaatcgttactcgaagcaaagtcagcgggtttctct
gatgtcctgttcctggatgcagcaactggtagaaacatcgaagagcttactgcttgtaac
atcttcattgtcaagggaaacattgtatccaccccaccaacttcaggaaccattttacct
ggagtcacgaggaaaagcataagtgagctggctcatgatattggctaccaggtcgaagaa
cgcgatgtatctgtggatgagctactagaggcagaagaagttttctgcacagggactgca
gtggtcgttaaagctgttgaaactgtgaccttccatgacaaaaaggtaaaatacaggaca
ggagaagcagcattgtctacgaagcttcactcgatgttgaccaatattcagatgggagtt
gttgaagataagaaaggttggatggtggacattgatccttgtcaaggttga

KEGG   Arabidopsis thaliana (thale cress): AT3G49680
Entry
AT3G49680         CDS       T00041                                 
Symbol
BCAT3
Name
(RefSeq) branched-chain aminotransferase 3
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00270  Cysteine and methionine metabolism
ath00280  Valine, leucine and isoleucine degradation
ath00290  Valine, leucine and isoleucine biosynthesis
ath00770  Pantothenate and CoA biosynthesis
ath00966  Glucosinolate biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01210  2-Oxocarboxylic acid metabolism
ath01230  Biosynthesis of amino acids
ath01240  Biosynthesis of cofactors
Module
ath_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
ath_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
ath_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AT3G49680 (BCAT3)
   00280 Valine, leucine and isoleucine degradation
    AT3G49680 (BCAT3)
   00290 Valine, leucine and isoleucine biosynthesis
    AT3G49680 (BCAT3)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT3G49680 (BCAT3)
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    AT3G49680 (BCAT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ath01007]
    AT3G49680 (BCAT3)
Enzymes [BR:ath01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     AT3G49680 (BCAT3)
Amino acid related enzymes [BR:ath01007]
 Aminotransferase (transaminase)
  Class IV
   AT3G49680 (BCAT3)
SSDB
Motif
Pfam: Aminotran_4 DUF3110 DUF4649 DUF4022
Other DBs
NCBI-GeneID: 824130
NCBI-ProteinID: NP_566923
TAIR: AT3G49680
UniProt: Q9M401 A0A654FG91
Position
3:18422542..18425758
AA seq 413 aa
MERAAILPSVNQNYLLCPSRAFSTRLHSSTRNLSPPSFASIKLQHSSSSVSSNGGISLTR
CNAVSSNSSSTLVTELADIDWDTVGFGLKPADYMYVMKCNIDGEFSKGELQRFGNIEISP
SAGVLNYGQGLFEGLKAYRKKDGNNILLFRPEENAKRMRNGAERMCMPAPTVEQFVEAVT
ETVLANKRWVPPPGKGSLYVRPLLMGTGAVLGLAPAPEYTFIIYVSPVGNYFKEGVAPIN
LIVENEFHRATPGGTGGVKTIGNYAAVLKAQSIAKAKGYSDVLYLDCIYKRYLEEVSSCN
IFIVKDNVISTPEIKGTILPGITRKSMIDVARTQGFQVEERNVTVDELLEADEVFCTGTA
VVVSPVGSVTYKGKRVSYGEGTFGTVSKQLYTVLTSLQMGLIEDNMKWTVNLS
NT seq 1242 nt   +upstreamnt  +downstreamnt
atggagagagcagcaattctcccgagtgttaatcaaaattacctactttgtccttcacgc
gccttctccacgcgcctccactcctctactcgtaacttatcgccgccgtcatttgcctcc
atcaagcttcagcattcttcttcctctgtttcttctaatggtggaatctctcttactcga
tgcaacgctgtttcgtccaattcttccagtacgttggtaactgaattagccgacatagat
tgggataccgttggatttgggcttaagccagctgattatatgtatgtgatgaaatgtaac
attgatggagagttctcaaaaggtgagttgcaacgttttgggaatattgaaattagccca
tctgctggtgtactcaactatggacagggattgtttgaagggctaaaagcttacagaaag
aaagatggtaataacatcctcctctttcgtcctgaggagaatgcaaagcgtatgagaaat
ggtgctgagaggatgtgtatgcctgctccaaccgttgagcagtttgtagaagctgtgaca
gaaactgtactagcaaacaaacgttgggttccaccaccaggtaaaggttccttatatgtt
agaccattgctaatgggaacaggagctgttcttggtcttgcgcctgcaccagaatatact
ttcattatctatgtttcgcctgttgggaactacttcaaggaaggtgtggcacctatcaat
ttgattgtggagaatgaatttcaccgtgcaactcctggtggtaccggaggtgttaaaacc
ataggcaattatgctgcagtactgaaggcacagtcaattgcgaaagctaaaggatattcc
gatgttttgtaccttgattgcatttacaaaagatatcttgaggaggtctcgtcttgcaat
attttcatcgtgaaggacaatgtgatatctactcctgaaataaaaggaaccattttaccc
ggtattactcgaaaaagtatgatagacgtggctcgaacacaagggtttcaggtggaggaa
cggaatgtgacagtggatgaattgttagaagcagacgaggttttctgcacaggaaccgcc
gtggttgtctctcctgttggaagcgtcacttacaaaggcaaaagagtgtcttacggagaa
ggtaccttcggaactgtgtcgaagcaactctacaccgttctgacaagcttgcagatgggt
ctgattgaagacaacatgaaatggactgtgaatcttagttaa

KEGG   Arabidopsis thaliana (thale cress): AT5G65780
Entry
AT5G65780         CDS       T00041                                 
Symbol
ATBCAT-5
Name
(RefSeq) branched-chain amino acid aminotransferase 5 / branched-chain amino acid transaminase 5 (BCAT5)
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00270  Cysteine and methionine metabolism
ath00280  Valine, leucine and isoleucine degradation
ath00290  Valine, leucine and isoleucine biosynthesis
ath00770  Pantothenate and CoA biosynthesis
ath00966  Glucosinolate biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01210  2-Oxocarboxylic acid metabolism
ath01230  Biosynthesis of amino acids
ath01240  Biosynthesis of cofactors
Module
ath_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
ath_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
ath_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AT5G65780 (ATBCAT-5)
   00280 Valine, leucine and isoleucine degradation
    AT5G65780 (ATBCAT-5)
   00290 Valine, leucine and isoleucine biosynthesis
    AT5G65780 (ATBCAT-5)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT5G65780 (ATBCAT-5)
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    AT5G65780 (ATBCAT-5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ath01007]
    AT5G65780 (ATBCAT-5)
Enzymes [BR:ath01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     AT5G65780 (ATBCAT-5)
Amino acid related enzymes [BR:ath01007]
 Aminotransferase (transaminase)
  Class IV
   AT5G65780 (ATBCAT-5)
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 836707
NCBI-ProteinID: NP_201379
TAIR: AT5G65780
UniProt: Q9FYA6 A0A384KYR5 Q0WQT2
Position
5:26311311..26318857
AA seq 415 aa
MERSAVASGFHRNYILCASRAATSTTRLHSLSSLRNFPSSSLRIRHCPSPISSNFIVSEV
SRNRRCDAVSSSTTDVTELAEIDWDKIDFGLKPTDYMYAMKCSRDGEFSQGQLQPFGNID
INPAAGVLNYGQGLFEGLKAYRKQDGNILLFRPEENAIRMRNGAERMCMPSPTVEQFVEA
VKTTVLANKRWIPPPGKGSLYIRPLLMGTGAVLGLAPAPEYTFLIFVSPVGNYFKEGVAP
INLIVETEFHRATPGGTGGVKTIGNYAAVLKAQSIAKAKGYSDVLYLDCLHKRYLEEVSS
CNIFIVKDNVISTPEIKGTILPGITRKSIIEVARSQGFKVEERNVTVDELVEADEVFCTG
TAVVLSPVGSITYKSQRFSYGEDGFGTVSKQLYTSLTSLQMGLSEDNMNWTVQLS
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggagagaagcgccgttgcctcaggttttcatagaaattacatcctctgtgcttcacgc
gccgccacttccacgacgcgcctccactctttgtcctccctcagaaactttccctcttcc
tctctcaggattcgtcactgtccttctcccatctcttccaatttcatcgttagtgaagtt
tcccgaaaccgacgatgcgacgccgtttcttccagcaccaccgatgtgactgaattagcc
gaaattgattgggacaagattgattttgggcttaaaccaacggattacatgtacgccatg
aaatgtagccgtgatggtgaattctctcaaggtcaattgcaaccttttggtaacattgac
attaacccagcagctggtgttctcaactatggacaaggtttgtttgaaggtctaaaagct
tacagaaaacaagatgggaatattctactcttccgtcctgaggagaatgcgatccgaatg
agaaatggcgctgaaagaatgtgtatgccttctccaaccgttgaacagtttgttgaggct
gtgaaaactactgtattagctaacaaacgctggattccacctccaggtaaaggatcatta
tacataaggccattgctaatgggaactggagctgttcttggtcttgctcctgctcctgaa
tacactttccttatctttgtttcacctgtcgggaactacttcaaggaaggtgttgcgccg
atcaacttaattgttgaaactgaattccatcgtgcaactcccggcggtactggaggtgtt
aaaaccatcggtaattatgctgcagtcttgaaggctcagtcgattgcgaaagctaaaggg
tattctgatgttttataccttgattgccttcacaaaagatatcttgaggaggtttcatcg
tgcaatattttcattgtgaaggataatgtgatatctactcctgaaattaaaggaaccatc
ttgcctggaattacccggaagagtatcatcgaagtagctcgtagccaaggtttcaaggtg
gaggaacgaaatgtgacagttgatgaattggtagaagcagacgaggttttctgcacagga
accgccgttgttttatctccggttggaagcatcacttacaaaagccaaaggttttcttat
ggagaagatggctttggaacagtctcgaaacaactctacacttccttgacgagcctgcaa
atgggtctgagcgaagataacatgaactggactgttcaattgagttaa

DBGET integrated database retrieval system