KEGG   Arabidopsis thaliana (thale cress): AT1G11475
Entry
AT1G11475         CDS       T00041                                 
Symbol
NRPB10
Name
(RefSeq) RNA polymerases N / 8 kDa subunit
  KO
K03007  DNA-directed RNA polymerases I, II, and III subunit RPABC5
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT1G11475 (NRPB10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT1G11475 (NRPB10)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT1G11475 (NRPB10)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     AT1G11475 (NRPB10)
  RNA polymerase III system
   RNA polymerase III
     AT1G11475 (NRPB10)
  RNA polymerase I system
   RNA polymerase I
     AT1G11475 (NRPB10)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      AT1G11475 (NRPB10)
SSDB
Motif
Pfam: RNA_pol_N Chordopox_RPO7
Other DBs
NCBI-GeneID: 837690
NCBI-ProteinID: NP_849640
TAIR: AT1G11475
UniProt: Q8LFJ6 A0A178WP73
Structure
Position
1:3862399..3864074
AA seq 71 aa
MIIPVRCFTCGKVIGNKWDQYLDLLQLDYTEGDALDALQLVRYCCRRMLMTHVDLIEKLL
NYNTLEKSDNS
NT seq 216 nt   +upstreamnt  +downstreamnt
atgatcatccctgttcgttgctttacttgtggaaaggtgattggaaacaaatgggatcag
tatcttgatcttctccagctcgactacactgaaggggacgcacttgatgcactccagcta
gtcagatactgctgcaggcgtatgctaatgactcatgttgatctgattgagaagcttctc
aactacaacactctggagaaatcagacaacagttag

KEGG   Arabidopsis thaliana (thale cress): AT1G61700
Entry
AT1G61700         CDS       T00041                                 
Name
(RefSeq) RNA polymerases N / 8 kDa subunit
  KO
K03007  DNA-directed RNA polymerases I, II, and III subunit RPABC5
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT1G61700
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT1G61700
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT1G61700
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     AT1G61700
  RNA polymerase III system
   RNA polymerase III
     AT1G61700
  RNA polymerase I system
   RNA polymerase I
     AT1G61700
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      AT1G61700
SSDB
Motif
Pfam: RNA_pol_N
Other DBs
NCBI-GeneID: 842467
NCBI-ProteinID: NP_176363
TAIR: AT1G61700
UniProt: Q9SYA6 A0A178WGP5
Position
1:22787012..22788380
AA seq 71 aa
MIVPVRCFTCGKVIGNKWDTYLELLQADYAEGDALDALGLVRYCCRRMLMTHVDLIEKLL
NYNTMEKSDPN
NT seq 216 nt   +upstreamnt  +downstreamnt
atgatcgtccctgttcgttgttttacttgtggaaaggtgattgggaacaaatgggacaca
taccttgaacttctccaggctgattacgctgaaggggatgctcttgacgcgcttggatta
gtccgttactgctgcaggcgtatgcttatgactcatgtcgatctaatcgaaaagcttcta
aactacaacactatggagaaatccgaccccaattaa

DBGET integrated database retrieval system