KEGG   Arabidopsis thaliana (thale cress): AT1G12350
Entry
AT1G12350         CDS       T00041                                 
Symbol
COAB
Name
(RefSeq) 4-phospho-panto-thenoylcysteine synthetase
  KO
K01922  phosphopantothenate---cysteine ligase (ATP) [EC:6.3.2.51]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00770  Pantothenate and CoA biosynthesis
ath01100  Metabolic pathways
ath01240  Biosynthesis of cofactors
Module
ath_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT1G12350 (COAB)
Enzymes [BR:ath01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.51  phosphopantothenate---cysteine ligase (ATP)
     AT1G12350 (COAB)
SSDB
Motif
Pfam: DFP NmrA
Other DBs
NCBI-GeneID: 837789
NCBI-ProteinID: NP_001321808
TAIR: AT1G12350
UniProt: Q8GXR5 A0A5S9U0A8
Position
1:4198337..4200849
AA seq 317 aa
MSSISGLVEDEISSFFESSPPLKNKEEIVANLNQFIELNSSCQGGMRRIVCVTSGGTTVP
LEQRCVRYIDNFSSGNRGAASTENFVKAGYAVIFLYRRGTCQPYCRYLPDDPFLECFEFP
DAKNIQVHGSHSGAVKMAVMDQQAAVAEGRLLKLPFSTIYEYLQMLRLIATILKDVGPCS
MFYLAAAVSDFYVPWLSMTEHKIESGSGPLDIRLAQVPKMLSILRSNWAPKAFCISFKLE
TDSKILLEKATKALQKYKVHAVVANELLTRKEEVVVVSSSGNVVVRRDSNKPESIVEDNL
IRLLVDRHSTYIKESLT
NT seq 954 nt   +upstreamnt  +downstreamnt
atgagttcgatctctggattggtggaagatgaaatcagttcgtttttcgaatcgtctcca
cctctgaagaacaaggaagagatcgtagccaatcttaatcagttcattgagctgaattct
tcgtgtcaaggagggatgaggaggattgtatgtgtgacttcaggtggaactacagttcca
ttggagcaacgatgtgtaagatacattgataatttcagctctggaaatagaggtgctgct
tctactgagaatttcgtcaaggctggatatgctgtgatatttctctataggaggggaact
tgtcaaccgtattgccggtatcttcctgatgatccattccttgaatgttttgagtttcca
gatgccaaaaacattcaagttcatgggtcacattcaggagctgtgaagatggctgttatg
gaccagcaagctgcagttgcagaaggtcgcttgcttaaactcccattctcaaccatatat
gaatatctccagatgttgcggttgattgctacgatattgaaagatgtcggtccatgttcg
atgttttatcttgctgctgctgtatctgacttctatgtgccatggttaagcatgacagag
cacaaaatagaatcaggatctggtcctttggacataagactagctcaagtccctaaaatg
ctttcaatcttgagatcaaattgggctccaaaggctttctgcatatcattcaagcttgag
acagactcaaagattttgctagagaaagctacaaaggctttacaaaaatacaaagtgcac
gcagttgtagcaaatgaactattaacgcgtaaggaggaagttgtggttgtttcaagtagc
ggtaatgttgtggtgagacgtgatagcaataagccggaatctatcgtagaagataatctc
attcgtctcctcgtagatcgacattcaacatacatcaaagaatctctcacttga

KEGG   Arabidopsis thaliana (thale cress): AT5G02080
Entry
AT5G02080         CDS       T00041                                 
Name
(RefSeq) phosphopantothenate-cysteine ligase-like protein
  KO
K01922  phosphopantothenate---cysteine ligase (ATP) [EC:6.3.2.51]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00770  Pantothenate and CoA biosynthesis
ath01100  Metabolic pathways
ath01240  Biosynthesis of cofactors
Module
ath_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT5G02080
Enzymes [BR:ath01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.51  phosphopantothenate---cysteine ligase (ATP)
     AT5G02080
SSDB
Motif
Pfam: DFP
Other DBs
NCBI-GeneID: 831921
NCBI-ProteinID: NP_195828
TAIR: AT5G02080
UniProt: Q9LZM3
Position
5:409699..411770
AA seq 270 aa
MEEILENLNEFIKLNSSSQGGRRIVCVTSGGTTVPLEQRCVRYIDNFSSGNRGAASTENF
VKAGYAVIFLYRRGTCQPYCRSLPDDPFLECFEFSDKTNIQGSLLKLPFSTIYEYLQMLR
LIAEALKDVGPCSMFYLAAAVSDFYVPWKSMTEHKIESGSGPLDIRLAQVPKMLSVLRSN
WAPKAFCISFKLETDSKILMEKATKALRKYKVHAVVANELSTRKEEVVVVSSSGNVVVRR
ECDKPESFVEDNLIRLIVDRHSTYIKESHN
NT seq 813 nt   +upstreamnt  +downstreamnt
atggaggagattctagagaatcttaatgagttcatcaaactgaattcatcgtcacaaggg
ggaaggaggattgtatgtgtgacttcagggggaacaacggttccattggagcaacgatgt
gttaggtatatcgataatttcagctccggaaacagaggtgctgcttctactgagaatttc
gtcaaggctggatatgctgtgatatttctgtataggaggggaacttgccaaccgtattgt
cgatctcttcccgatgatccattccttgaatgttttgagttttctgataagactaacatt
caaggcagcttactaaaactcccattctcaaccatatatgagtatcttcagatgttgcgg
ttgattgcagaggcattgaaagatgttggtccatgttcaatgttttatcttgctgctgct
gtatctgacttctatgtgccatggaagagcatgacagagcacaaaatagaatcaggatct
ggtcctttagacataagactagctcaagtccctaaaatgctatcagtcttgagatcaaat
tgggctccaaaggccttctgcatatcattcaagcttgagacagactcaaagattctgatg
gagaaggctacaaaggctctaagaaaatacaaagtgcacgcagttgtagccaatgagcta
tcaacccgtaaggaagaagttgtggttgtttcaagcagcggtaatgttgtggttagacgc
gaatgcgataagcctgaatcttttgttgaagataatctcattcgtctcatcgtagatcga
cattcaacatacatcaaagaatctcacaactga

DBGET integrated database retrieval system