KEGG   Arabidopsis thaliana (thale cress): AT1G18090
Entry
AT1G18090         CDS       T00041                                 
Name
(RefSeq) 5'-3' exonuclease family protein
  KO
K10746  exonuclease 1 [EC:3.1.-.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    AT1G18090
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ath03032]
    AT1G18090
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT1G18090
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-
    3.1.-.-
     AT1G18090
DNA replication proteins [BR:ath03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    AT1G18090
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     AT1G18090
SSDB
Motif
Pfam: XPG_I XPG_N XPG_I_2 5_3_exonuc DUF4313 HemY_N
Other DBs
NCBI-GeneID: 838389
NCBI-ProteinID: NP_564047
TAIR: AT1G18090
UniProt: Q94A33 A0A178W174
Position
1:6224405..6227822
AA seq 577 aa
MGIKDLLRFMKPYILPIHIQKYAGKRVGIDAYSWLHKGAYSCSMELCLDTDGKKKLRYID
YFMHRVNLLQHYEIIPVVVLDGGNMPCKAATGDERHRKRKANFDAAMVKLKEGNVAAATE
LFQRAVSVTSSMAHQLIQVLKSENVEFIVAPYEADAQLAYLSSLELEQGGIAAVITEDSD
LLAYGCKAVIFKMDRYGKGEELVLDNVFQAVDQKPSFQNFDQELFTAMCVLAGCDFLPSV
PGVGISRAHAFISKYQSVELVLSFLKTKKGKLVPDDYSSSFTEAVSVFQHARVYDFDAKK
LKHLKPLSHNLLNLPVEQLEFLGPDLSPSVAVAIAEGNVDPITMKAFNHFSVSRKPLKTP
VRSFKEQEKGSSFLVCSLSKSEEIIELKRTADEAMIDPEAIVKKKMYSKQDSDLYKLLAQ
PNRDQVVTRPSNPSLIPDNNPFKIRKTDEINLEIAEYGVQELADSFVTKSKAVDVASSSP
NSHEHEDQKECVTIDLSKLDAAGIKQDSEKNRVKETFETTEVDLAEVQDHVNMTTKRVRG
TKPRTENFKVKTSCKSSENNKTIIKKKHSILDFFQRL
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgggcatcaaggaccttctcagattcatgaaaccttatatccttcccattcacatccag
aaatacgccgggaaacgagtgggaatcgatgcttattcatggctacacaaaggagcatac
tcatgtagtatggagttgtgtttagacactgatgggaagaagaagctgaggtacattgat
tactttatgcatagagtcaaccttcttcaacactatgagatcattcctgtcgttgttctc
gatggtggtaatatgccctgcaaggctgccactggtgatgaacgtcataggaagcgaaag
gctaactttgacgctgcaatggtgaagctgaaggaagggaatgtcgcagcagctactgag
ctttttcagagagcagttagtgtaacatcatccatggctcatcaattgattcaggttctg
aaatcagaaaacgtcgaatttattgtagctccctatgaggctgatgctcagctagcatac
ctatccagcctcgaactggaacaaggcgggattgctgctgttataaccgaagacagcgat
ttacttgcatatggctgcaaagctgttatctttaagatggaccgctatggtaaaggagag
gaactagttctagataatgtttttcaagctgttgatcaaaagccttccttccagaatttt
gatcaagagctattcactgcaatgtgcgtattggcgggctgtgattttctcccctcggtt
cctggtgttggtatttcaagagctcatgcattcatctccaagtaccagagtgtagaactc
gttttgtcatttctcaagacaaaaaaaggcaaactagttcctgatgattattccagctct
ttcacggaagcagtttcagtttttcagcacgcacgtgtatatgactttgacgctaagaag
ctcaagcacttgaaacccctctcccacaacctcctgaatttaccagttgaacaacttgag
ttcctgggaccagatctgtcgccatctgttgctgttgcaattgctgaaggtaatgttgat
cccataaccatgaaagcttttaaccacttctcggtttctaggaaaccgttgaagacgcct
gttcgatcattcaaggaacaggaaaagggaagctcctttttggtatgttctttgtctaaa
agtgaggaaataatagagctcaaaaggactgcagatgaagctatgattgatccagaagct
attgtgaagaagaagatgtactctaaacaagattcagatctatacaaactgcttgcgcag
cctaacagggatcaagtggttacccgacccagcaatccctcacttattccggacaacaac
ccgttcaagattagaaaaaccgatgaaatcaatctggaaatcgcagaatacggtgtgcaa
gaactcgctgattcgtttgtgaccaaaagcaaagcagtggacgtggcttcttcttcacca
aactctcacgaacacgaggatcaaaaagagtgtgttacaatcgatctgtccaaacttgat
gccgctggaatcaaacaggacagtgagaagaacagagtgaaagaaacatttgaaacaaca
gaagtagatctagctgaagttcaagatcatgtgaacatgacgacaaagagagtgcgtgga
acaaaacctagaaccgagaatttcaaagtgaaaacaagctgtaaaagttcagagaacaac
aagactataatcaagaagaaacacagtatattagatttcttccagcgattgtaa

KEGG   Arabidopsis thaliana (thale cress): AT1G29630
Entry
AT1G29630         CDS       T00041                                 
Name
(RefSeq) 5'-3' exonuclease family protein
  KO
K10746  exonuclease 1 [EC:3.1.-.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    AT1G29630
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ath03032]
    AT1G29630
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT1G29630
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-
    3.1.-.-
     AT1G29630
DNA replication proteins [BR:ath03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    AT1G29630
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     AT1G29630
SSDB
Motif
Pfam: XPG_N XPG_I XPG_I_2 5_3_exonuc TPR_1 MIT HHH_5
Other DBs
NCBI-GeneID: 839840
NCBI-ProteinID: NP_001077624
TAIR: AT1G29630
UniProt: Q8L6Z7
Position
1:10349427..10353833
AA seq 735 aa
MGIQGLLPLLKSIMVPIHIKELEGCIVAVDTYSWLHKGALSCSRELCKGLPTKRHIQYCM
HRVNLLRHHGVKPIMVFDGGPLPMKLEQENKRARSRKENLARALEHEANGNSSAAYECYS
KAVDISPSIAHELIQVLRQENVDYVVAPYEADAQMAFLAITKQVDAIITEDSDLIPFGCL
RIIFKMDKFGHGVEFQASKLPKNKDLSLSGFSSQMLLEMCILSGCDYLQSLPGMGLKRAH
ALITKFKSYDRVIKHLKYSTVSVPPLYEESFKRALLTFKHQRVYDPNAEDIIHLCDISDN
LGEDSDFVGPSMPQDIAKGIALGQLDPFTQLPFQAESVTPKLAVDDISRPKSFKPETVKK
KLDLPVQKNLLTKYFCFASVEAKRKFKAPRISPMSLTPTDESPSIPDDNTPDLDALSSQT
TNESPVYSLGENPCVSEVAEKRDSPDDDAVERNHKDLHHKYCEREVDRPKSDSLKVIVRS
KYFKQKQEDKSLKQSIPCLNDCSVIGQRKAVKTVINMSSASKREESHRAIATSPCLHHDR
IYNDHEDAKEASFSAMNEVAERTINTHKINHQINEEEQNPSVEIPSAFSTPENVIPLSSI
AIDSCHGVATGKRKLDSDENLHKENLKSKHMRMDETDTALNAETPLETDDVEKFGSNISH
IGHYSEIAEKSVERFVSAISSFKYSGTGSRASGLRAPLKDIRNTCPSKGLSLKPDISKFG
YASSNRHMVTKSRRM
NT seq 2208 nt   +upstreamnt  +downstreamnt
atgggtatacaagggcttttgccgttgttgaaatcgataatggtaccgattcatatcaag
gagctcgagggttgtatcgtcgccgtcgatacatattcatggctacacaaaggggcttta
tcttgtagccgagagctctgcaagggattacccaccaagaggcatattcaatactgtatg
catagagtgaatttacttcgccatcatggagtgaagcctatcatggtctttgatggaggt
ccgttaccgatgaaactagaacaagagaataagcgtgctaggtccagaaaggaaaatctt
gctcgtgcattggagcatgaagcaaatggaaattcctcagctgcttatgagtgctactca
aaggccgtagatatttcaccttctattgcacatgagttgatacaggttctgaggcaggag
aatgttgattacgttgttgctccttacgaagctgatgcgcagatggcattcttagctatt
actaagcaagttgatgcgattatcactgaggattctgatctcataccttttggctgccta
agaatcattttcaaaatggacaagtttggtcatggtgttgagtttcaagcctccaagcta
cccaaaaataaggatctcagtctatcaggattttcaagccaaatgcttctcgaaatgtgc
atattaagtggctgcgattatttgcagtcacttccaggaatgggactcaaaagagcacat
gcactcattacaaaattcaaaagctatgacagggtaattaagcacttaaagtacagcaca
gtttcagttcctcctctttatgaagagtcattcaagagagctttactgactttcaagcat
caacgtgtctatgacccaaatgctgaagatatcatacacttgtgtgacatttctgacaac
cttggtgaagattcagattttgtaggcccatcgatgccacaagatattgctaagggtata
gctctaggccagcttgatcccttcacacagttgccattccaggctgagagtgttactcct
aaattggctgttgatgatatatcccgtcccaaaagtttcaaacctgaaactgtaaagaaa
aagcttgatttgccagtccaaaaaaaccttctcaccaagtacttctgctttgcgtctgtt
gaggcaaaaagaaaattcaaggctcctaggatatcaccaatgtctctgaccccaactgat
gagtctccaagcattcctgatgacaacacaccagatttagatgctctttcaagccagaca
acaaatgaatccccggtttatagcttgggtgagaatccatgtgttagcgaagttgcagag
aaaagagattcacccgatgacgatgcagtggaaaggaatcacaaggaccttcatcataaa
tactgcgaacgggaagtggataggccgaagtcagatagtttgaaggttatagtaagaagc
aagtattttaagcagaaacaggaggacaaaagtctgaaacaatcgatcccatgtcttaat
gattgctctgtgattggtcagagaaaggctgttaaaactgtgattaacatgtcaagcgcg
tctaaaagagaagagagtcacagagctatagcaacaagtccatgtttacaccatgaccga
atctacaacgatcatgaagatgctaaagaagcgagtttctctgccatgaacgaggtggct
gagagaacaataaacacccacaagattaaccatcagatcaatgaagaagaacagaaccca
tccgttgaaattccttctgcctttagtactcccgagaatgttatacctctctcttccatt
gctattgatagttgccatggagttgcaacagggaagaggaagcttgactcagatgaaaac
cttcacaaggaaaatttgaaatccaagcacatgcgcatggatgaaactgatactgctctt
aatgcagaaacaccattagaaaccgatgatgttgagaagtttggatcgaacatttcacat
atagggcattactcagaaatagcagagaaatcagtggaaagatttgtctcagctatatcg
tctttcaaatattctgggactggctctcgtgctagcggtctccgtgcccctctcaaagat
atccgcaacacttgtccgtccaaagggttatctcttaaaccagacatcagcaagtttggc
tatgcgtcaagcaaccgacacatggtgacaaagtcaaggagaatgtga

DBGET integrated database retrieval system