KEGG   Arabidopsis thaliana (thale cress): AT1G21690
Entry
AT1G21690         CDS       T00041                                 
Symbol
EMB1968
Name
(RefSeq) ATPase family associated with various cellular activities (AAA)
  KO
K10755  replication factor C subunit 2/4
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03030  DNA replication
ath03420  Nucleotide excision repair
ath03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AT1G21690 (EMB1968)
   03420 Nucleotide excision repair
    AT1G21690 (EMB1968)
   03430 Mismatch repair
    AT1G21690 (EMB1968)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ath03032]
    AT1G21690 (EMB1968)
   03036 Chromosome and associated proteins [BR:ath03036]
    AT1G21690 (EMB1968)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT1G21690 (EMB1968)
DNA replication proteins [BR:ath03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    AT1G21690 (EMB1968)
  DNA Replication Termination Factors
   ELG1-RFC complex
    AT1G21690 (EMB1968)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    AT1G21690 (EMB1968)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     AT1G21690 (EMB1968)
  Check point factors
   HRAD17(Rad24)-RFC complex
    AT1G21690 (EMB1968)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 AAA_22 Rad17 RuvB_N AAA_16 Mg_chelatase ResIII AAA_11 AAA_24 AAA_5 AAA_14 AAA_assoc_2 AAA_19 DUF2075 DNA_pol3_delta PhoH AAA_18 DEAD RNA_helicase AAA_7 AAA_30 AAA_25 DUF5906 AAA_28 bpMoxR IstB_IS21 TIP49 DUF815 AAA_23 Sigma54_activat
Other DBs
NCBI-GeneID: 838771
NCBI-ProteinID: NP_564148
TAIR: AT1G21690
UniProt: Q93ZX1 A0A178WH05
Position
1:7615505..7618628
AA seq 339 aa
MAPVLQSSQPWVEKYRPKQVKDVAHQEEVVRVLTNTLQTADCPHMLFYGPPGTGKTTTAL
AIAHQLFGPELYKSRVLELNASDDRGINVVRTKIKDFAAVAVGSNHRQSGYPCPSFKIII
LDEADSMTEDAQNALRRTMETYSKVTRFFFICNYISRIIEPLASRCAKFRFKPLSEEVMS
NRILHICNEEGLSLDGEALSTLSSISQGDLRRAITYLQSATRLFGSTITSTDLLNVSGVV
PLEVVNKLFTACKSGDFDIANKEVDNIVAEGYPASQIINQLFDIVAEADSDITDMQKAKI
CKCLAETDKRLVDGADEYLQLLDVASSTICALSEMAQDF
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggcgccagttcttcagagctcacagccatgggttgagaaataccggccgaagcaggtt
aaggacgtggctcaccaggaagaggtggttcgtgtcctcaccaacactctccagactgct
gactgcccgcacatgctcttctatggaccaccaggcactggaaaaaccactactgctctt
gccatcgctcaccagctctttggacctgaactatacaagtctagggtgttggagcttaat
gcaagtgatgacagaggtattaatgttgttcggactaagatcaaggattttgctgctgtt
gctgttgggtctaatcatcgtcaaagtggttatccttgcccatcgtttaagatcatcatc
ctagatgaggctgattcgatgacagaagatgctcagaatgccttgaggcgcacaatggaa
acttactccaaagtcaccagattctttttcatatgtaattacatcagcaggatcatagag
ccccttgcttccaggtgtgcgaagttcaggtttaaaccactttccgaagaagtcatgagt
aaccgtatattgcatatttgtaatgaagaaggtctcagccttgatggagaggctctttca
actttgagctccatatcacaaggtgatctccgtagggccatcacatatctgcagagtgct
actcggttgtttggatcaacaataacttctacagatttactcaatgtgtctggggtagtt
cctctagaggtagtcaataaactttttactgcatgcaaaagtggtgatttcgatattgca
aacaaggaagtggataacatagttgcagaaggatatcctgcatctcaaatcatcaatcag
ctattcgatatagttgcggaggctgacagtgacataacagacatgcaaaaggctaagatc
tgcaaatgtttagctgaaactgataagcgacttgtagacggggcggatgagtacttgcag
cttctggatgtggcaagcagtacaatttgtgccctctcagaaatggctcaagacttctaa

KEGG   Arabidopsis thaliana (thale cress): AT1G63160
Entry
AT1G63160         CDS       T00041                                 
Symbol
RFC2
Name
(RefSeq) replication factor C 2
  KO
K10755  replication factor C subunit 2/4
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03030  DNA replication
ath03420  Nucleotide excision repair
ath03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AT1G63160 (RFC2)
   03420 Nucleotide excision repair
    AT1G63160 (RFC2)
   03430 Mismatch repair
    AT1G63160 (RFC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ath03032]
    AT1G63160 (RFC2)
   03036 Chromosome and associated proteins [BR:ath03036]
    AT1G63160 (RFC2)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT1G63160 (RFC2)
DNA replication proteins [BR:ath03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    AT1G63160 (RFC2)
  DNA Replication Termination Factors
   ELG1-RFC complex
    AT1G63160 (RFC2)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    AT1G63160 (RFC2)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     AT1G63160 (RFC2)
  Check point factors
   HRAD17(Rad24)-RFC complex
    AT1G63160 (RFC2)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 AAA_14 Rad17 AAA_22 AAA_16 Viral_helicase1 Mg_chelatase AAA_11 AAA_5 RuvB_N AAA_19 AAA_24 AAA_18 AAA_30 AAA_assoc_2 bpMoxR MeaB AAA_28 AAA_25 RNA_helicase AAA_7 ABC_tran DEAD DUF2075 IstB_IS21 KTI12 NTPase_1 T2SSE AAA_3 SRP54
Other DBs
NCBI-GeneID: 842620
NCBI-ProteinID: NP_176504
TAIR: AT1G63160
UniProt: Q9CAM7 A0A178WFQ7
Position
1:complement(23421834..23423914)
AA seq 333 aa
MASSSSTSTGDGYNEPWVEKYRPSKVVDIVGNEDAVSRLQVIARDGNMPNLILSGPPGTG
KTTSILALAHELLGTNYKEAVLELNASDDRGIDVVRNKIKMFAQKKVTLPPGRHKVVILD
EADSMTSGAQQALRRTIEIYSNSTRFALACNTSAKIIEPIQSRCALVRFSRLSDQQILGR
LLVVVAAEKVPYVPEGLEAIIFTADGDMRQALNNLQATFSGFSFVNQENVFKVCDQPHPL
HVKNIVRNVLESKFDIACDGLKQLYDLGYSPTDIITTLFRIIKNYDMAEYLKLEFMKETG
FAHMRICDGVGSYLQLCGLLAKLSIVRETAKAP
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggcgtcttcttcatcaacctctaccggtgacggatacaatgaaccatgggtggagaaa
tacaggccgagcaaagtagtcgatatcgttggaaacgaagacgccgtctccagacttcaa
gtcattgctcgcgacggcaacatgcctaatcttatcctttccggtcctcctggaacaggt
aaaaccacaagcattttggctcttgctcatgagctccttggcacgaattacaaggaggct
gttctggagttgaatgcatctgatgataggggtattgatgttgtaaggaacaaaattaag
atgtttgcgcagaagaaagtaacacttcctccagggcgtcataaggttgttatcctagat
gaagctgacagtatgacatctggagcacaacaagcattgaggagaacgattgaaatctat
tcgaactctacgcggtttgcacttgcttgtaatacatcagccaagattattgagcccatt
cagagtagatgtgccttagttcgattctctagattatctgatcagcagatactaggccgt
ctcttggtggtggttgcagcagagaaagttccgtatgtgcctgaaggccttgaggcgata
atctttacagctgatggtgacatgaggcaagctctgaacaacttgcaagccacattcagc
gggttttcgtttgtcaaccaagaaaacgtcttcaaggtctgtgaccagcctcacccgctt
catgtcaagaacattgttcgcaatgtgttggaaagtaagtttgacatcgcctgtgacggc
ttaaagcagctctatgatttgggctactctccaaccgacattatcacaacgcttttccgt
ataataaagaattacgatatggctgagtatctgaaacttgagttcatgaaggaaactgga
tttgcgcatatgagaatctgtgatggagttggatcttatcttcagctatgtggtcttctg
gctaagttatccattgttcgtgaaacagcgaaagcaccttaa

KEGG   Arabidopsis thaliana (thale cress): AT1G77470
Entry
AT1G77470         CDS       T00041                                 
Symbol
RFC3
Name
(RefSeq) replication factor C subunit 3
  KO
K10756  replication factor C subunit 3/5
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03030  DNA replication
ath03420  Nucleotide excision repair
ath03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AT1G77470 (RFC3)
   03420 Nucleotide excision repair
    AT1G77470 (RFC3)
   03430 Mismatch repair
    AT1G77470 (RFC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ath03032]
    AT1G77470 (RFC3)
   03036 Chromosome and associated proteins [BR:ath03036]
    AT1G77470 (RFC3)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT1G77470 (RFC3)
DNA replication proteins [BR:ath03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    AT1G77470 (RFC3)
  DNA Replication Termination Factors
   ELG1-RFC complex
    AT1G77470 (RFC3)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    AT1G77470 (RFC3)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     AT1G77470 (RFC3)
  Check point factors
   HRAD17(Rad24)-RFC complex
    AT1G77470 (RFC3)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 Rad17 AAA_assoc_2 AAA_22 AAA_11 AAA_14 AAA_16 AAA_5 RuvB_N AAA_24 AAA_19 AAA_30 ResIII DUF815 AAA_3 AAA_7 ATPase_2 bpMoxR MCM DEAD AAA_18 TniB TIP49 Pup_ligase Mg_chelatase
Other DBs
NCBI-GeneID: 844083
NCBI-ProteinID: NP_177871
TAIR: AT1G77470
UniProt: Q9CAQ8 A0A178WIQ9
Position
1:complement(29111948..29114548)
AA seq 369 aa
MTELTSAMDIDVDEIQPRKPINKGKDVVGFGPPPQSKATPWVEKYRPQSLDDVAAHRDII
DTIDRLTNENKLPHLLLYGPPGTGKTSTILAVARKLYGPKYRNMILELNASDDRGIDVVR
QQIQDFASTQSFSLGKSSVKLVLLDEADAMTKDAQFALRRVIEKYTKSTRFALIGNHVNK
IIPALQSRCTRFRFAPLDGVHMSQRLKHVIEAERLVVSDCGLAALVRLSNGDMRKALNIL
QSTHMASKEITEEESKQITEEDVYLCTGNPLPKDIEQISHWLLNKPFDECYKDVSEIKTR
KGLAIVDIVKEITLFIFKIKMPSAVRVQLINDLADIEYRLSFGCNDKLQLGAIISTFTHA
RSIIVGAAK
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgactgagctaacgtcggcgatggacattgacgtagacgaaattcagcctcgcaagccg
ataaacaagggcaaagacgtcgtcggttttggacctccgccgcagagtaaggcgacgcct
tgggttgagaagtatcgacctcagtcgcttgatgacgtggctgcacatcgtgacattatt
gatacgattgataggctgaccaatgagaacaaattgccccatcttctgttgtatggtcct
cccggtactggcaaaacatccaccattctagctgttgcccggaaactatatggaccaaag
taccggaatatgattcttgaactgaacgcatcagacgatagaggaatcgatgttgtaagg
cagcagattcaagatttcgctagcacgcagagtttctctttaggaaaatcttcggtgaag
ttggttttgctagatgaagcagatgccatgacaaaagatgctcagtttgccttgcgtaga
gtgattgagaaatacactaagagtactaggtttgcgctcattggaaaccatgtcaataag
atcatcccagctttgcagtcgagatgtactcgatttagatttgcccctcttgatggagtt
catatgagtcaacgtcttaaacatgtaatagaagctgaaaggcttgttgtaagtgactgt
ggtttggcagctcttgtacggctgagcaatggggacatgagaaaagcattgaacattttg
cagtcaacgcatatggcgtcaaaggaaattacagaggaagagtcaaagcaaattacagag
gaagacgtttacctctgcaccggaaacccattgcccaaggacattgagcagatatctcac
tggcttctgaataaaccatttgatgagtgctacaaagacgtttcagaaatcaagacgaga
aaaggacttgccattgttgatatcgtcaaagagattaccttgtttatttttaaaatcaag
atgccttccgctgtcagagttcaactgataaacgatttggcagacattgagtacagatta
agttttggttgcaacgacaaactgcagcttggagctatcatttctactttcacacatgcc
cggtctatcattgttggtgcagcaaagtaa

KEGG   Arabidopsis thaliana (thale cress): AT5G22010
Entry
AT5G22010         CDS       T00041                                 
Symbol
RFC1
Name
(RefSeq) replication factor C1
  KO
K10754  replication factor C subunit 1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03030  DNA replication
ath03420  Nucleotide excision repair
ath03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AT5G22010 (RFC1)
   03420 Nucleotide excision repair
    AT5G22010 (RFC1)
   03430 Mismatch repair
    AT5G22010 (RFC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ath03032]
    AT5G22010 (RFC1)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT5G22010 (RFC1)
DNA replication proteins [BR:ath03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    AT5G22010 (RFC1)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     AT5G22010 (RFC1)
SSDB
Motif
Pfam: RFC1 BRCT AAA PTCB-BRCT AAA_30 AAA_22 DNA_pol3_delta AAA_5 AAA_16 Rad17 BRCT_2 AAA_18 RuvB_N AAA_2 Zeta_toxin Sigma54_activ_2 AAA_14 AAA_28 NTPase_1 VbhA TsaE
Other DBs
NCBI-GeneID: 832261
NCBI-ProteinID: NP_680188
TAIR: AT5G22010
UniProt: Q9C587
Position
5:complement(7280321..7287434)
AA seq 956 aa
MSDIRKWFMKAHEKGNGSAPKSTSSKAGPVKNAAETAPIKSEQASEDLETADRRKTSKYF
GKDKTKVKDEKEVEAIPAKRKLKTESDDLVKPRPRKVTKVVDDDDDDFDVPISRKTRDTT
PSKKLKSGSGRGIASKTVDNDDDDDGEDKETPLKSAGRGRGGRAAPGASTGGRGRGGGRG
GFMNFGERKDPPHKGEKEVPEGTPDCLAGLTFVISGTLDSLEREEAEDLIKRHGGRITGS
VSKKTTYLLCDEDIGGRKSEKAKELGTKFLTEDGLFDIIRSSKPVKKSLPERSNKGTEKI
CAPPKTSPQKEETRGKPLAKSSPKKVPPAKGKNKIIETSLPWTEKYRPKVPNEIVGNQSL
VTQLHNWLSHWHDQFGGTGSKGKGKKLNDAGSKKAVLLSGTPGIGKTTSAKLVSQMLGFQ
AVEVNASDSRGKANSNIAKGIGGSNANSVKELVNNEAMAANFDRSKHPKTVLIMDEVDGM
SAGDRGGVADLIASIKISKIPIICICNDRYSQKLKSLVNYCLPLNYRKPTKQQMAKRLMH
IAKAEGLEINEIALEELAERVNGDIRLAVNQLQYMSLSMSVIKYDDIRQRLLSSAKDEDI
SPFTAVDKLFGYNGGKLRMDERIDLSMSDPDLVPLLIQENYLNYRPSGKDEAKRMDLLAR
AAESIADGDIINVQIRRYRQWQLSQSCCVASSILPASLLHGSREVLEQGERNFNRFGGWL
GKNSTAGKNRRLMEDLHVHVLASRESSAGRETLRVDYLPLLLSRLTSPLQTLPKDEAVSE
VVDFMNSYSISQEDFDTILELGKFKGRENPMEGVPPPVKAALTKKYNEMNKTRMVRVADM
VQLPGVKKAPKKRIAAMLEPTVDSLRDEDGEPLADNEEGNGSDAEEDSEEATDGEKLESN
LKNLNARGIQVELDLKGAGSSGSRKAAGKGRGRGKAADTSAEKKATGRGSGAKRKR
NT seq 2871 nt   +upstreamnt  +downstreamnt
atgtcggatattaggaagtggtttatgaaagctcatgaaaaagggaatggaagtgctccg
aaatcgacgtcttccaaggcaggtcctgtgaagaatgctgcagagactgcaccaataaaa
tcagagcaggctagtgaagacttggaaactgctgatagaagaaaaacgagcaagtatttt
ggtaaagataaaacaaaagttaaagatgagaaagaggtggaagcaattcctgccaagagg
aaacttaagactgagtctgatgatttagtcaagcctcgtccaagaaaggttacaaaggtt
gttgatgatgatgatgatgattttgatgtacctatttcaaggaagactcgtgataccact
cccagcaaaaaactaaagtcggggtcaggtagaggaattgcaagtaaaactgttgataac
gacgatgatgatgatggtgaagataaggagactcctctaaaatctgccggaagaggccgt
ggcggtagagctgctccaggggcctcaactggtggaagaggtagaggtggagggcgaggt
ggatttatgaattttggtgaaaggaaagacccaccgcataaaggagaaaaggaagttcct
gaaggcacccctgattgcttagctggattgacatttgtaattagcggaacacttgacagt
ttagaaagagaagaagcagaagatctgattaagcggcatggtggtcgtattacaggctct
gttagcaagaaaacgacctaccttttgtgtgatgaagacattggcggaaggaaatctgaa
aaagctaaagagctgggcactaagttccttacagaggatggcctatttgacataatccgg
tcctctaaacctgtaaaaaagtctctacctgaaaggtcaaacaaaggcactgaaaaaatc
tgtgcaccaccgaagacaagtcctcagaaagaagaaacaagaggaaaacctttggcaaaa
agttcgcccaaaaaggtccccccggcgaaaggaaaaaataaaattatcgagacttccttg
ccctggacggaaaaatacagaccgaaggttccaaatgagattgttgggaatcagtcgttg
gttactcaacttcacaactggctgtcccactggcatgatcaatttggaggtactggaagt
aaaggaaaggggaagaaattgaatgatgctggttccaagaaagctgtacttttgagtgga
acacctggtattggaaaaacaacatcagcaaagttggttagtcagatgcttggtttccag
gcagttgaggttaatgctagtgacagtcgtggaaaggcgaactcgaatattgccaaagga
attggtggcagcaatgcaaattctgtaaaagaacttgtcaataacgaagccatggctgcc
aacttcgataggtcaaagcacccgaagactgttctaatcatggatgaagtagatggaatg
tctgcaggcgacaggggaggtgttgcagatcttattgctagcattaaaatatcaaagatt
cctatcatctgcatttgtaatgaccgatatagtcaaaaactgaagagtttagtaaactac
tgtcttcccctcaattaccggaagcccacgaaacagcagatggcaaaaaggctgatgcat
attgctaaggcagaaggccttgaaattaatgaaattgccctggaagaactcgctgagaga
gtgaatggtgacatacgattggccgtaaatcagctccaatatatgagcctgtccatgtca
gtcatcaaatacgatgatatcaggcagcgcctgctaagcagtgcgaaggatgaagatatt
tcccctttcacagctgttgacaagttgtttggttacaatggtgggaagctgagaatggat
gaacggattgacctaagcatgagtgatccggatttggttcccctacttatacaggaaaac
tatctcaattataggccaagcggtaaagatgaggcaaaacgaatggatttactcgctcgt
gctgctgaatctattgccgatggagatattatcaacgtgcagattcgaagatacagacaa
tggcagctctctcaatcttgctgtgttgcatcttctattctcccagcttcattgttgcat
ggatcaagggaggtactcgagcagggagagcgtaatttcaatagatttggtgggtggctt
ggcaagaattctactgcgggaaaaaatagacggttaatggaggatctgcatgttcatgtc
cttgcttcccgtgaatccagcgctggaagggagacacttcgtgttgattatcttcccctt
ctcttgagccgcttgactagcccacttcagacactgcctaaggatgaagcagtttcagaa
gttgttgatttcatgaactcctactctataagccaggaggactttgatactattttggag
ttgggaaaatttaagggacgtgaaaatccgatggagggtgttccacctccagttaaagca
gctttgaccaaaaaatataatgagatgaataaaaccagaatggtacgtgtggcggacatg
gtgcagcttccgggagtgaaaaaggcgccaaagaagcgaatagctgctatgctggaacca
actgttgatagtttgagagatgaagatggtgagccgttagcagataatgaagaaggaaat
ggatcagacgctgaagaagactcagaagaagcaaccgatggagaaaagctggagtccaat
cttaaaaatctgaatgctagagggatccaagtggaattggatttgaaaggagctggaagc
tcaggttcaagaaaggcggctggtaaaggcagaggcagagggaaagcagctgatacgtct
gctgagaagaaagctacaggaagaggctctggtgccaagagaaagagataa

KEGG   Arabidopsis thaliana (thale cress): AT5G27740
Entry
AT5G27740         CDS       T00041                                 
Symbol
EMB2775
Name
(RefSeq) ATPase family associated with various cellular activities (AAA)
  KO
K10756  replication factor C subunit 3/5
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03030  DNA replication
ath03420  Nucleotide excision repair
ath03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AT5G27740 (EMB2775)
   03420 Nucleotide excision repair
    AT5G27740 (EMB2775)
   03430 Mismatch repair
    AT5G27740 (EMB2775)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ath03032]
    AT5G27740 (EMB2775)
   03036 Chromosome and associated proteins [BR:ath03036]
    AT5G27740 (EMB2775)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT5G27740 (EMB2775)
DNA replication proteins [BR:ath03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    AT5G27740 (EMB2775)
  DNA Replication Termination Factors
   ELG1-RFC complex
    AT5G27740 (EMB2775)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    AT5G27740 (EMB2775)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     AT5G27740 (EMB2775)
  Check point factors
   HRAD17(Rad24)-RFC complex
    AT5G27740 (EMB2775)
SSDB
Motif
Pfam: DNA_pol3_delta2 AAA Rad17 DNA_pol3_delta Sigma54_activ_2 AAA_16 AAA_5 ABC_tran RsgA_GTPase AAA_22 RuvB_N AAA_29 Mg_chelatase AAA_23 DUF5906 Bac_DnaA T2SSE DUF815 AAA_24 Rep_fac_C ATPase_2 AAA_11 TsaE Prenyltransf RNA_helicase AAA_33
Other DBs
NCBI-GeneID: 832836
NCBI-ProteinID: NP_198126
TAIR: AT5G27740
UniProt: Q8VXX4 A0A654G4M8
Position
5:9823513..9827243
AA seq 354 aa
MLWVDKYRPKSLDKVIVHEDIAQKLKKLVSEQDCPHLLFYGPSGSGKKTLIMALLKQIYG
ASAEKVKVENRAWKVDAGSRTIDLELTTLSSTNHVELTPSDAGFQDRYIVQEIIKEMAKN
RPIDTKGKKGYKVLVLNEVDKLSREAQHSLRRTMEKYSSSCRLILCCNSSSKVTEAIKSR
CLNVRINAPSQEEIVKVLEFVAKKESLQLPQGFAARIAEKSNRSLRRAILSLETCRVQNY
PFTGNQVISPMDWEEYVAEIATDMMKEQSPKKLFQVRGKVYELLVNCIPPEVILKRLLHE
LLKKLDSELKLEVCHWAAYYEHRMRLGQKAIFHIEAFVAKFMSIYKNFLISTFG
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgttgtgggtcgacaagtacaggccgaaatcactcgacaaggtcatagttcatgaagat
atcgcccaaaaactcaagaaattggtttccgagcaagattgtccacatttgctcttttat
gggccgtcaggttctggtaagaaaaccctaattatggctcttctcaagcagatatatggg
gccagtgcagagaaggtgaaagtggagaacagggcatggaaagttgatgctgggagtaga
actattgatctggagctcactacattatcaagcaccaatcatgtggaacttactccaagt
gatgcaggctttcaggacagatatattgttcaggagataattaaagaaatggccaagaac
agaccaattgacacgaaaggaaagaagggatataaggtgttggtattaaatgaggttgac
aagctctcacgagaagctcaacattctctgcggagaacaatggagaaatacagctcatct
tgccgtctcatcttatgctgcaacagctcttcgaaggttaccgaagccattaagtctcgt
tgtctcaatgtgcgcataaatgcaccttcgcaggaagagatagtgaaagtgttggagttc
gttgcaaagaaagaaagtctgcaactgccccagggttttgctgctcgtattgctgaaaaa
tcaaatcgcagtctaagaagagctattttgtcacttgaaacttgtcgtgtccaaaactat
ccgttcacaggtaaccaagtgatatctcccatggattgggaagagtatgttgctgaaata
gcaactgacatgatgaaagaacaaagccctaaaaagttatttcaggtgcgtggaaaggtg
tacgaattactagttaattgtattccaccagaagtcattctaaagagactccttcatgaa
ttgctgaagaaactggactcagagctaaagcttgaagtctgccactgggctgcatattat
gaacatcggatgcgattaggtcagaaagccatatttcacatagaagcatttgtggccaag
tttatgagcatatacaaaaacttcctcatttcaacgtttgggtag

DBGET integrated database retrieval system