KEGG   Arabidopsis thaliana (thale cress): AT1G29940
Entry
AT1G29940         CDS       T00041                                 
Symbol
NRPA2
Name
(RefSeq) nuclear RNA polymerase A2
  KO
K03002  DNA-directed RNA polymerase I subunit RPA2 [EC:2.7.7.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT1G29940 (NRPA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT1G29940 (NRPA2)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     AT1G29940 (NRPA2)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Core subunits
     AT1G29940 (NRPA2)
SSDB
Motif
Pfam: RNA_pol_Rpb2_6 RNA_pol_Rpb2_1 RNA_pol_Rpb2_3 RNA_pol_Rpb2_7 RNA_pol_Rpa2_4 RNA_pol_Rpb2_2
Other DBs
NCBI-GeneID: 839872
NCBI-ProteinID: NP_564341
TAIR: AT1G29940
UniProt: F4I366 A0A178W5B4
Position
1:complement(10479007..10486824)
AA seq 1178 aa
MVVNAKDSTVPTMEDFKELHNLVTHHIESFDYMTLKGLDVMFNRIKPVSVYDPNTENELS
IWLENPLVFAPQKESFKSTSRKEPLLPFECRQAKISYTGTFMADVCFKYNDGVVVRDKFD
FGQFPIMLMSKLCSLKGADCRKLLKCKESTSEMGGYFILNGIERVFRCVIAPKRNHPTSM
IRNSFRDRKEGYSSKAVVTRCVRDDQSSVTVKLYYLRNGSARVGFWIVGREYLLPVGLVL
KALTNSCDEEIYESLNCCYSEHYGRGDGAIGTQLVRERAKIILDEVRDLGLFTREQCRKH
LGQHFQPVLDGVKKESLSIVAEAVLRDYLFVHLDNDHDKFNLLIFIIQKLYSLVDQTSLP
DNPDSLQNQEILVPGHVITIYLKEKLEEWLRKCKSLLKDELDNTNSKFSFESLADVKKLI
NKNPPRSIGTSIETLLKTGALKTQSGLDLQQRAGYTVQAERLNFLRFLSFFRAVHRGASF
AGLRTTTVRKLLPESWGFLCPVHTPDGTPCGLLNHMTRTSRITSQFDSKGNIRDFLKIRK
SVVDVLTGAGMVPSLPKLVRAGPPKVIHVLLDGQVVGTLSSNLVTKVVSYIRRLKVEAPS
VIPEDLEVGYVPTSMGGSYPGLYLASCPARFIRPVKNISIPSDNIELIGPFEQVFMEISC
PDGGNGGRNNSSLATHEEIHPTGMISVVANLTPWSDHNQSPRNMYQCQMAKQTMAYSTQA
LQFRADQKIYHLQTPQSPVVRTKTYTTYSIDENPTGTNAIVAVLAHTGFDMEDAMILNKS
SVERGMCHGQIYQTENIDLSDQNSRFDSGSKSFRRSTNKAEHFRIDADGLPSVGQKLYPD
EPYCSIYDEVTNKTRHMKRKGTDPVIVDFVSVDMKSKKHPQRANIRFRHARNPIIGDKFS
SRHGQKGVCSQLWPDIDMPFNGVTGMRPDLIINPHAFPSRMTIAMLLESIAAKGGSLHGK
FVDATPFRDAVKKTNGEEESKSSLLVDDLGSMLKEKGFNHYGTETLYSGYLGVELKCEIF
MGPVYYQRLRHMVSDKFQVRSTGQVDQLTHQPIKGRKRGGGIRFGEMERDSLLAHGASYL
LHDRLHTSSDHHIADVCSLCGSLLTSSVVNVQQKKLIQEIGKLPPGRTPKKVTCYSCKTS
KGMETVAMPYVFRYLAAELASMNIKMTLQLSDREGVTD
NT seq 3537 nt   +upstreamnt  +downstreamnt
atggttgtgaacgcgaaagactcgacggttccaacgatggaagacttcaaggagcttcac
aatctcgttactcatcatatagagtctttcgattacatgacactgaaaggactcgatgtt
atgttcaatcgaatcaaacccgtttctgtttacgatccaaacaccgagaatgaattgagc
atttggttagaaaatcctctagtatttgctccacagaaggagagttttaaatcaacatca
aggaaagagcctttgcttccctttgagtgtaggcaagcgaagatttcgtacacaggaacg
tttatggctgatgtttgctttaagtataatgatggagtcgttgttagagacaagtttgat
tttgggcaatttcctattatgctcatgtcaaagctttgtagcttaaagggtgctgattgc
cggaaactgttaaagtgtaaagagtcaacttctgaaatgggagggtactttattttgaat
gggattgagagagtgtttcgatgtgttattgcaccaaagcggaaccatccaacaagtatg
attcggaactcattccgtgatcgtaaggaaggatactctagcaaggcagttgtcactagg
tgtgttagggacgaccagtcatctgttactgttaaactgtattatcttcgcaatggaagt
gccagagttggattttggatagtgggaagggaatatttgcttcctgtcggccttgttctc
aaggctctaacgaattcctgcgatgaggaaatatacgaaagcctgaactgttgctacagt
gagcattacggaagaggggatggagctattggaacccaacttgttcgtgagagagccaaa
attattcttgatgaagttcgagacttgggtctttttacccgtgaacagtgccggaagcac
ttaggacagcattttcaacctgttcttgatggggtaaaaaaagaaagcctttctatcgtt
gctgaagctgtgctcagggattatttatttgttcaccttgacaatgatcacgacaagttc
aatttgctcatcttcataattcagaagctctattctctggtggatcagacttctttacct
gacaatccggattctttgcaaaatcaggaaattttagtcccaggtcacgttataactatt
tacctcaaggaaaaacttgaagaatggctgcggaagtgtaaaagtcttcttaaagatgag
ttggataacacgaactcaaaattttcctttgaaagccttgctgatgtcaagaagcttatt
aacaaaaatcctcccaggagtattggtacgtcaattgaaacattgttaaagacaggagcg
ttgaaaacacagtctggtttggatttacagcagagagcaggttacactgttcaggctgag
agactgaactttctccgtttcctttcatttttccgggcggttcatcgaggtgcttctttt
gctggacttcgtacaacaactgtgaggaagctgcttcctgaatcttggggttttctttgc
cctgttcacactcctgatggaacaccttgtggattactgaatcatatgactcgtactagc
cgaatcacttctcagttcgattccaagggaaacatcagagattttctgaaaataagaaag
tcagttgttgatgttcttactggggcgggtatggtaccttcattgccaaagctagtacga
gctggaccaccaaaagtcatccatgttcttttagatggtcaagttgtaggcacgctatct
tctaacctagtcacgaaagttgtctcttatatacggagactgaaagtggaggctccttca
gtgattcctgaagacctcgaagtgggatacgtacctacaagcatgggtggatcttaccct
ggattgtatttggcatcatgtcccgcaagattcattaggcctgttaaaaatatatctata
ccttctgataatattgaactgattggaccatttgaacaggtttttatggaaataagctgt
cctgatggtggaaatggaggaaggaataactcttccctagcaactcacgaggaaattcat
ccaaccgggatgataagtgtggttgctaatcttacaccttggtcagatcataaccaaagt
ccccgtaacatgtatcagtgtcagatggcgaaacaaaccatggcgtactctactcaagca
ctccaatttcgtgccgaccagaagatttaccacctgcagactcctcaatcccctgtggtc
cgcacaaaaacatacaccacttacagtattgatgagaatcctacagggactaatgcaatt
gttgctgtcctcgcacatacaggatttgatatggaagacgcgatgattttgaacaaatca
tctgtggagcggggaatgtgccatgggcaaatataccagacagaaaatattgatctttca
gatcagaatagccgatttgatagtggttctaaaagttttaggaggagtactaacaaagca
gaacattttcgtatcgatgctgatgggttaccatctgttggacagaaattatatccagat
gagccgtattgtagtatctatgatgaggtaactaacaaaacaaggcacatgaagcgtaaa
ggtaccgaccctgtcatagttgactttgtctctgtcgacatgaaaagcaagaaacatcct
caaagggcgaatattcgtttccggcatgccagaaaccccataatcggtgacaagttcagc
agtagacatgggcaaaagggtgtttgttctcaattgtggcctgatattgacatgccattt
aatggagttactggaatgcgtccagatctcatcattaacccgcatgctttcccatcaaga
atgacaattgctatgcttttggaatctattgctgctaagggaggtagtttgcatggaaag
tttgtagatgcaacaccgtttcgtgatgcagtaaaaaaaacaaacggagaagaggagagc
aagtccagtttgcttgttgatgatcttggctccatgttaaaggaaaaagggttcaaccat
tatggtaccgagacattgtatagtgggtatttaggagtagaactgaagtgtgagatattt
atggggcctgtttactaccagagactgcgtcacatggtctcagacaaattccaggttaga
tctacgggacaagtggatcagctaactcatcagccaataaagggaagaaaacgaggtggt
gggattcggtttggtgaaatggagcgagactcactacttgctcatggagcctcctatcta
ttacacgacaggcttcatacatcttcagatcaccacattgcagatgtgtgttcgctatgt
ggaagcttgctcacatcatctgttgtgaacgttcaacagaagaagcttattcaagaaatt
ggaaagttacctcctggtagaactccaaagaaggtaacttgctattcttgcaagacaagt
aaaggcatggaaacagttgcaatgccctatgtgttcaggtacttggctgcagagttggct
tcaatgaatattaagatgactcttcagttaagcgatagagaaggagtaactgattaa

DBGET integrated database retrieval system