KEGG   Arabidopsis thaliana (thale cress): AT1G31670
Entry
AT1G31670         CDS       T00041                                 
Name
(RefSeq) Copper amine oxidase family protein
  KO
K00276  primary-amine oxidase [EC:1.4.3.21]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00260  Glycine, serine and threonine metabolism
ath00350  Tyrosine metabolism
ath00360  Phenylalanine metabolism
ath00410  beta-Alanine metabolism
ath00950  Isoquinoline alkaloid biosynthesis
ath00960  Tropane, piperidine and pyridine alkaloid biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT1G31670
   00350 Tyrosine metabolism
    AT1G31670
   00360 Phenylalanine metabolism
    AT1G31670
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT1G31670
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    AT1G31670
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    AT1G31670
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.21  primary-amine oxidase
     AT1G31670
SSDB
Motif
Pfam: Cu_amine_oxid Cu_amine_oxidN3 Cu_amine_oxidN2
Other DBs
NCBI-GeneID: 840054
NCBI-ProteinID: NP_174448
TAIR: AT1G31670
UniProt: P0DN99
Position
1:11337536..11341889
AA seq 741 aa
MVNRDNSIVALSFFMLFLLVLHLHFETTTAARKPVRVFGPPSSIEWSPPSPPKDDFEWFE
INIYKNIEQTAFRPTGQGPSQGIGHKDPPVFSSVFVIGSLSFIPPPHPFDPLTEIELNLV
RNIINERYPIGLEHRFTFQYVGLNEPDKSLVLSWVSSQYHNVKSPPRQAFVIARDHGKTR
EIVVDFASQAIVSEKIHVGNGYPMLTIDEQQATSELVLKFKPFRDSIRRRGLNVSEVVVT
TSTMGWFGEAKPERLIKKRPFYLNGSVNTYLRPIEGMTIIVNLDQMKVTKFRDRFTSPLP
NAKGTEFRISKLKPPFGPSLQNAVLFQSEGPGFKIDGHTNRWANWEFHMSFDVRAGLVIS
LASIFDMDVNKYRQVLYKGHLSEIFVPYMDPSEDWYFRTFFDCGEFGCGQYAVSLEPYTD
CPGNAAFMDGVFASQDGTPIKITNVMCIFEKYAGDIMWRHTEIEIPGLKVRPDVSLVVRM
VTTVGNYDYIVDYEFKPSGSIKIGVGLTGVLEVKPVKYVNTSEIKEDDIHGTIVADNTIG
VNHDHFVTYRLDLDIDGTDNSFVRSELVTKRTPKSVNTPRKSYWTTKRLKAEELLVVNPS
RKTKHGNEVGYRLLHGPASEGPLLAQDDYPQIRAAFTNYNVWITPYNNTEVWASGLYADR
SQGDDTLAVWSQRNRKIEKTDIVMWYTVGFHHVPCQEDFPTMPTLFGGFELRPTNFFEQN
PDLKTKPIKLNTTPTCTARND
NT seq 2226 nt   +upstreamnt  +downstreamnt
atggtgaaccgtgataattctattgtggctttatccttttttatgctcttcttgcttgtg
ttacatctgcattttgaaactacaacagctgcgcgaaaaccagttagagtgtttggtccg
ccaagttctatcgagtggtcaccaccatcaccaccaaaggatgactttgaatggttcgag
atcaatatatacaagaacattgaacaaactgcattccgacccactggtcaaggtcctagc
caaggcatcggacacaaggatccacctgtattttcttccgtttttgtaatcggatcctta
agcttcatcccaccgcctcacccatttgatcccttgactgagatcgaactcaatctcgtc
cgtaacatcatcaacgaaaggtaccccattggtctggaacataggttcactttccagtac
gtgggtctcaacgaacccgacaagtccctagtcttatcctgggtttcatcacaataccac
aatgtcaagtcaccaccacgtcaggcattcgtcatcgctcgagatcacggaaagacccga
gagatcgtcgtggactttgcctctcaagccattgtttcggaaaagattcacgtaggaaat
ggttaccctatgcttacaattgacgagcaacaagcaaccagcgagcttgttctcaagttc
aagccgttccgtgactcaatcaggagacgtggcttgaacgtgtccgaggttgttgtcacg
acctcaacgatgggatggtttggtgaggcgaagccggagaggcttataaaaaagagaccg
ttttatctgaatgggtcggtgaacacttaccttagacctatagaaggaatgacgataatc
gttaaccttgaccagatgaaagtaacgaagtttagagataggtttacgagtcctttgcct
aatgctaagggaaccgagttccgtatctcgaagctaaaaccgccgtttggcccgtcgctt
caaaacgccgtcctttttcagtcggaggggcctgggtttaaaatcgatggacacacgaat
agatgggcaaattgggaattccacatgtcatttgacgtacgagctggtcttgttatctct
cttgcgtccattttcgacatggacgttaacaaataccgtcaagtcctatacaaaggccat
ttgtcggaaatatttgtaccttatatggatccaagtgaagattggtacttcagaactttt
tttgactgtggtgaatttggttgcggccaatatgctgtgtctcttgaaccttacaccgat
tgtcccggtaacgctgccttcatggacggcgtctttgcaagccaagacggaactccgata
aaaatcacaaatgttatgtgcatcttcgagaaatatgccggagacattatgtggcggcat
accgaaattgaaattcccggcttaaaagtaagaccggacgtaagtcttgtggtccggatg
gtgacgaccgtggggaactacgactatatagttgattacgagttcaaacctagtggttcc
atcaaaattggggtcggtttaacaggtgttttagaagttaaaccggtgaaatatgttaac
acatccgagatcaaagaagacgatatccatgggacaatcgtcgcggacaacaccattgga
gttaaccacgaccatttcgtgacataccgtcttgatcttgacattgatggcacggataat
tcttttgtccgtagtgaacttgtgaccaagaggacaccaaaatctgttaacacgcctagg
aagagctattggacaacgaaacggctgaaagcagaggagttgttggtggttaaccctagt
aggaaaacaaagcacggtaatgaggttggataccgtttacttcatgggccggcttctgaa
ggtccacttctggctcaagatgattacccacaaattcgggcagcatttaccaactataat
gtgtggatcacgccgtacaacaacacggaggtttgggccagcggtttgtacgctgaccgg
agccaaggcgacgacacgttagccgtttggtcccaaaggaataggaaaatagagaagaca
gatatagtgatgtggtacactgtcggattccaccatgtcccttgccaggaagattttccg
acgatgcctactttgtttggtggctttgaactccgaccgaccaactttttcgagcaaaat
cctgaccttaagaccaaacccatcaaactcaacaccacaccaacgtgcactgccaggaac
gattaa

KEGG   Arabidopsis thaliana (thale cress): AT1G31690
Entry
AT1G31690         CDS       T00041                                 
Name
(RefSeq) Copper amine oxidase family protein
  KO
K00276  primary-amine oxidase [EC:1.4.3.21]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00260  Glycine, serine and threonine metabolism
ath00350  Tyrosine metabolism
ath00360  Phenylalanine metabolism
ath00410  beta-Alanine metabolism
ath00950  Isoquinoline alkaloid biosynthesis
ath00960  Tropane, piperidine and pyridine alkaloid biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT1G31690
   00350 Tyrosine metabolism
    AT1G31690
   00360 Phenylalanine metabolism
    AT1G31690
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT1G31690
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    AT1G31690
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    AT1G31690
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.21  primary-amine oxidase
     AT1G31690
SSDB
Motif
Pfam: Cu_amine_oxid Cu_amine_oxidN3 Cu_amine_oxidN2
Other DBs
NCBI-GeneID: 840056
NCBI-ProteinID: NP_174450
TAIR: AT1G31690
UniProt: F4IAX0
Position
1:11343854..11347945
AA seq 677 aa
MAQVHLTIFIFSSIFVISSSSFIPPPHPFDPLTETELKLVRNIINKSYPIGHNHKFTFQY
VGLNEPEKSLVLSWHSSPDRNVKPPPRQAFVIARDKGMSREIVIDFSTRAIVSNKIHVGN
GNPMLTIDEQQAATAVVQKYKPFCDSIIKRGLNLSEVVVTSSTMGWFGETKTKRFIRTIP
FYLNGSVNTYLRPIEGMTIIVNLDQMKVTGFKDRFTGPMPKANGREYRISKLKPPFGPSL
RSAVVFQPDGPGFKIDGHVVRWANWEFHMSFDVRAGLVISLASIFDMDMNRYRQVLYKGH
LSEMFVPYMDPNDDWYFISYLDCGEFGCGQTAVSLEPYTDCPPNAAFMDGIFPGQDGTPT
KISNVMCIFEKYAGDIMWRHTEAEVPGLKITEVRPDVSLVARMVTTVGNYDYIIEYEFKP
SGSIKMGVGLTGVLEVKPVEYVHTSEIKEDDIYGTIVADNTVGVNHDHFVTFRLDLDIDG
TENSFVRTELVTKRTPKSVNTPRKSYWTTKRNTAKTEADARVKLGLRAEELVVVNPTKKT
KHGNEVGYRLLPGPASSPLLVQDDYPQIRAAFTNYNVWITPYNKSEVWASGLYADRSQGD
DTLAVWSQRDREIENKDIVMWYTVGFHHVPCQEDFPTMPTMFGGFELRPTNFFEQNPVLK
AKPFNLTTIPKCTTKNE
NT seq 2034 nt   +upstreamnt  +downstreamnt
atggctcaagttcacttaaccatttttatattttcttccattttcgtaatctcatcatct
agcttcatcccacctcctcaccccttcgatcccttgaccgagactgaactcaaacttgtc
cgtaacatcatcaacaagtcgtaccctattggtcataaccataagttcacgttccaatat
gtgggtctcaacgagcctgaaaagtccctagtcttgtcgtggcactcatcaccagaccgc
aacgtcaaaccaccaccacgtcaagcttttgtcatcgcccgagataagggcatgagccga
gagatcgttattgacttttccactcgagcaattgtctcgaacaagatccatgtaggcaat
ggtaacccaatgctaactattgacgagcagcaagcagccaccgcggttgttcaaaagtac
aagccgttctgtgactcgataataaaacgcggcttgaacttgtcggaagttgtggtcacc
tcctcaacgatgggatggtttggtgagacaaagacgaagaggtttataagaacgataccc
ttttatctaaacggatcggtgaacacgtatcttagaccaattgaaggaatgacgataatc
gttaaccttgaccagatgaaagtaacggggttcaaggacaggttcacgggtcctatgccg
aaggctaacgggagagagtaccgtatctcaaagctcaagccgccgtttggcccgtcgctt
cgaagtgccgtcgttttccagccggacggtccagggtttaagatcgatggacacgtcgtg
agatgggcaaattgggagtttcacatgtcatttgacgttcgagccggtcttgtcatctct
ctcgcgtccattttcgacatggacatgaacagataccggcaagtcctatacaaaggtcat
ttgtcggagatgttcgtaccttacatggacccaaatgacgactggtacttcattagttac
ctagactgtggtgaatttggctgcggccaaactgccgtatcccttgagccgtatactgat
tgtcccccgaatgccgctttcatggatggcatcttcccgggacaagatggaactcctaca
aaaatatcgaatgttatgtgcattttcgaaaaatatgctggagacattatgtggcgacat
accgaagctgaagtacccggcttaaaaatcacagaggttagaccagatgtaagtcttgta
gcccggatggtgacgacagtggggaactacgactacatcatcgagtatgagttcaaacca
agtggttccatcaaaatgggggtcggtttaaccggtgttttagaagttaaacctgtggaa
tatgttcacacatcagagatcaaagaagacgacatctacgggacaattgttgctgacaac
accgtcggagttaaccacgatcacttcgtgacattccgtcttgatcttgatatagatggt
acggaaaattcatttgttcgtaccgaactcgtgaccaagaggactccaaaatctgttaac
acaccgagaaaaagctattggacaacaaaacgaaacacagcaaaaaccgaggcagacgct
cgggtgaaactaggcttgagagcggaggagttggtggtcgttaaccctaccaaaaaaact
aagcatggcaatgaggttggataccgtctacttcctgggccggcttcaagcccacttctt
gtccaagatgactacccacagattcgggcagcattcaccaactacaacgtgtggatcaca
ccgtataacaaatcggaggtttgggctagcggtttgtacgctgatcggagccaaggtgac
gacacattagccgtatggtcccaaagagatagggaaatagagaacaaagatatagtgatg
tggtacaccgttggattccaccatgtcccatgccaagaagattttccgacgatgcctact
atgtttggcggctttgaacttcggccaaccaactttttcgagcaaaatcctgttctcaag
gctaaacctttcaatctcaccaccattccaaagtgtactacgaagaacgaataa

KEGG   Arabidopsis thaliana (thale cress): AT1G31710
Entry
AT1G31710         CDS       T00041                                 
Name
(RefSeq) Copper amine oxidase family protein
  KO
K00276  primary-amine oxidase [EC:1.4.3.21]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00260  Glycine, serine and threonine metabolism
ath00350  Tyrosine metabolism
ath00360  Phenylalanine metabolism
ath00410  beta-Alanine metabolism
ath00950  Isoquinoline alkaloid biosynthesis
ath00960  Tropane, piperidine and pyridine alkaloid biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT1G31710
   00350 Tyrosine metabolism
    AT1G31710
   00360 Phenylalanine metabolism
    AT1G31710
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT1G31710
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    AT1G31710
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    AT1G31710
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.21  primary-amine oxidase
     AT1G31710
SSDB
Motif
Pfam: Cu_amine_oxid Cu_amine_oxidN2 Cu_amine_oxidN3 T2SS-T3SS_pil_N
Other DBs
NCBI-GeneID: 840058
NCBI-ProteinID: NP_174452
TAIR: AT1G31710
UniProt: F4IAX1
Position
1:11349697..11355587
AA seq 681 aa
MAPLHFTILILFSFVIVVSSSSFTPPRHPFDPLTETELKLVRTIINKSYPVGPNHKFTFQ
YVGLNEPNKSLVLSWYSSPNHTIKPPPRQAFVIARDNGKTREIVLDFSSRAIVSDKIHVG
NGYPMLSNDEQEASTELVVKFKPFIDSVAKRGLNVSEIVFTTSTIGWYGETKAEAERVIR
LMPFYLDGTVNMYLRPIEGMTIIVNLDEMKVSEFKDRSVVTMPIANGTEYRISKLNPPFG
PTLHNAVLLQPDGPGFKVDGHIVRWANWEFHISFDVRAGIVISLASLFDTDVNKYRQVLY
KGHLSEMFIPYMDPSDDWYFITYLDCGDFGCGQCAVSLQPYTDCPAGAVFMDGIFAGQDG
TPAKIPKVMCIFEKYAGDIMWRHTEAEIPNLEITEVRPDVSLVARIVTTVGNYDYIVDYE
FKPSGSIKMGVGLTGVLEVKPVEYIHTSEIKLGEDIHGTIVADNTVGVNHDHFVTFRLHL
DIDGTENSFVRNELVTTRSPKSVNTPRKTYWTTKPKTAKTEAEARVKLGLKAEELVVVNP
NRKTKHGNEVGYRLLHGSAAGPLLAQDDFPQIRAAFTNYNVWITPYNRSEVWAGGLYADR
SQGDDTLAVWSQRNRKIEKEDIVMWYTVGFHHVPSQEDYPTMPTLSGGFELRPTNFFERN
PVLKTKPVKVTTARKCTPKND
NT seq 2046 nt   +upstreamnt  +downstreamnt
atggctccacttcacttcaccattctcatccttttctctttcgttatcgtagtctcatcc
tcaagctttactccaccgcgtcacccatttgatcccttaaccgagaccgaactcaaactc
gtccgaaccatcatcaacaagtcgtaccccgttggtccgaatcataagttcactttccaa
tacgttggtctcaacgaacccaacaagtctctagtcttgtcttggtactcatcaccgaat
cataccatcaaaccaccaccacgccaagcgttcgtcattgctcgagacaacggaaagacc
agagagatagtccttgacttttcctctcgtgccatcgtctcggacaaaattcacgtagga
aatggttaccctatgctctcaaacgacgagcaagaagcatccaccgagcttgttgtcaag
ttcaagccgtttattgactcggtcgcgaaacgtggcttaaacgtttcggagatcgtgttc
acgacgtcaacgattggatggtacggtgagactaaggccgaggcggagcgagttattaga
ttgatgccgttttatcttgacggcaccgttaatatgtatcttagacctattgaaggaatg
acgataatcgttaatcttgatgagatgaaggtatcggagtttaaggacaggtcagtggtt
actatgcccatagctaacggaacggagtaccgtatctcgaagcttaacccaccctttgga
ccgacgcttcataacgccgtccttttgcagccggatggtccgggcttcaaggtcgatgga
cacatcgtgaggtgggcaaattgggaatttcacatatcgttcgatgttcgagctggcatc
gtcatatctctcgcatcccttttcgacacggacgtgaacaaataccggcaagtcctatat
aaaggtcacttatcggaaatgttcataccttacatggacccaagtgatgattggtatttc
attacttatcttgattgtggcgattttggctgcggtcaatgcgccgtatctcttcaaccg
tacactgattgtccagcgggtgcagtttttatggatggtatttttgctggtcaagatgga
actcccgcaaaaatcccaaaagttatgtgcatttttgaaaaatatgctggagatatcatg
tggcgacatacagaagctgaaattccaaacttagaaattacggaggttagaccggacgta
agtcttgtagcccggattgtgacgaccgtgggaaactatgactacatagttgattatgag
ttcaagcctagtggttccatcaaaatgggggtcggcttaaccggtgttttagaagtgaaa
ccggtagaatatattcacacatccgaaatcaaactaggggaagacatacacgggacaatt
gtcgccgacaacaccgtcggtgttaaccacgaccatttcgtgacattccgtcttcatctt
gacatcgacggtaccgaaaattcctttgttcgtaacgaacttgtgaccacgaggtctcca
aaatctgttaacacaccgagaaaaacctattggacaacgaagccaaagacggccaagacc
gaggcagaggctcgggtgaaactaggtttgaaggcggaggagttagttgtggttaaccct
aaccgaaagacgaagcatggcaatgaggttggataccgtttacttcatggatccgctgca
ggcccactcctggcccaagatgatttcccgcagattcgagctgcattcaccaactataac
gtgtggatcacgccgtataacaggtcagaggtttgggcaggtggtttgtacgctgacagg
agccaaggcgacgatacgttggcagtgtggtctcaaaggaatagaaaaatagagaaggaa
gatatagtgatgtggtacaccgtcggtttccaccatgttcctagccaggaagattacccg
acgatgcctactttatccggtggctttgagctccgaccgaccaactttttcgagcgaaac
cctgtcctcaagaccaaacccgtcaaagttaccaccgctcgaaagtgcactcctaaaaac
gattaa

KEGG   Arabidopsis thaliana (thale cress): AT1G62810
Entry
AT1G62810         CDS       T00041                                 
Symbol
CuAO1
Name
(RefSeq) Copper amine oxidase family protein
  KO
K00276  primary-amine oxidase [EC:1.4.3.21]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00260  Glycine, serine and threonine metabolism
ath00350  Tyrosine metabolism
ath00360  Phenylalanine metabolism
ath00410  beta-Alanine metabolism
ath00950  Isoquinoline alkaloid biosynthesis
ath00960  Tropane, piperidine and pyridine alkaloid biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT1G62810 (CuAO1)
   00350 Tyrosine metabolism
    AT1G62810 (CuAO1)
   00360 Phenylalanine metabolism
    AT1G62810 (CuAO1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT1G62810 (CuAO1)
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    AT1G62810 (CuAO1)
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    AT1G62810 (CuAO1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.21  primary-amine oxidase
     AT1G62810 (CuAO1)
SSDB
Motif
Pfam: Cu_amine_oxid Cu_amine_oxidN2 Cu_amine_oxidN3
Other DBs
NCBI-GeneID: 842580
NCBI-ProteinID: NP_176469
TAIR: AT1G62810
UniProt: Q8H1H9
Position
1:complement(23257610..23262002)
AA seq 712 aa
MAEPSFARLFLLFFSFLLIFATYSWVFGPDSGFLFGTRVRKTLGSNRQVHVDHSLEKPHH
PLDPLTVREINRVRTILSNHDPGFGSGSATIHSMALDEPEKSRVVQWKKGNKLLSRRAAV
VAYWGGQTHEITVDLDSGRVVSDVINRTSGYPILTLNDVFAASQVPLKSLEFNRSIEARG
VKFSDLACITPFAGWFGSEEEGRRVIRVQCFTLQGTTNYFMRPLEGLYVTVDLDKLEVIK
IIDKGPIPIPKASGTEYRFGVQNKPVHMDRINPISMEQPDGPSFRVEDGHLVKWANWVFH
VKADQRAGMIISQATVRDSETGEPRSVMYKGFPSELFVPYMDPEEGWYYKGYMDAGELGL
GPTAMPLVPLNDCPRNSYYIDGVFASPDGKPIVQPNMICLFERYAGDISWRHSEILFANA
DIRESRPKVTLVARMATSVGNYDYIFDWEFQTDGLIRVTVAASGMLMVKGTPYDNVDDLG
DREDDAGPLISENVIGVVHDHFITFHLDMDIDGPMNNSLVKVHLEKQRVPTGKSPRKSYL
KVKKYIAKTEKDAQIKLSLYDPYEFHIVNPNRKSRVGNPAGYRIVPGGNAASLLDHDDPP
QIRGAFTNNQIWVTPYNRSEQYAGGVLIYQSQGDDTLQVWSDRDRSIENKDIVLWYTLGF
HHVPCQEDYPVMPTVAASFELKPANFFESNPILGSAPFFEKDLPVCRPFASS
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggcagaaccatcttttgctcgtctgtttctcttgttcttcagctttctccttatcttt
gccacctactcttgggtctttggacccgactcaggcttcttgttcggtactcgtgtccgg
aaaactctcggctcgaatcgtcaagtccacgttgaccactctttagaaaagcctcatcat
ccacttgatccactaacggtgcgagaaatcaatagagtcagaacaatactctcgaaccat
gacccgggttttggttccgggtcggccacgattcactccatggctctcgatgagccggag
aagtcacgtgtcgtccagtggaagaagggaaataagcttctgtcacgaagagctgcggtc
gtagcttattggggtggtcaaacacatgagataacggtggatcttgattcgggtcgggta
gtttctgatgtgattaaccggacttcagggtatccgattctcaccttgaacgacgtcttc
gctgcttcgcaggttcctttgaagagcttggaatttaaccgctccattgaagctcgtggg
gttaagttttccgatttagcttgcatcacaccgtttgccggatggtttggatcggaggaa
gaaggacgtagagtcataagagttcaatgtttcacgttacaaggcactaccaattatttt
atgagaccactcgaaggactttatgtaacggtcgatctagacaaattggaggttatcaag
atcatcgataaaggcccaattccaattcccaaagcctccggtacagaataccggtttggt
gttcagaataaaccggtgcatatggatcgtattaacccgatttcgatggagcaacctgac
ggtcccagttttagggtcgaagatgggcatttggttaagtgggctaattgggttttccat
gttaaagctgaccaacgagccggtatgatcatatctcaggccacggttcgtgactccgag
acaggtgaaccaagaagtgtgatgtacaaaggattcccatcagagttgtttgtaccgtac
atggaccctgaggaaggatggtactacaaaggttatatggatgcaggcgagctcggttta
ggacccacggcaatgccgctcgtgcctctcaacgattgccctcgaaattcttactatata
gacggtgttttcgcctctccagacggcaaacccattgttcaacctaatatgatatgcttg
tttgaacgctatgcaggcgatatcagctggcgacattctgagatcctttttgccaatgcc
gatataagagagtcaaggccaaaagttacattggtagctcgaatggcaacttcggttgga
aattacgactatattttcgattgggagtttcagactgatggtttgatccgtgttacggtc
gcggcttcgggaatgttaatggtgaaagggacaccttacgataatgtagatgacttaggt
gatagggaggatgatgctggaccgttgatctctgagaatgtgattggagtcgttcatgat
catttcataacgtttcatctagacatggatattgatggaccgatgaataattctttggtt
aaggttcatctagagaagcagagagttccaacaggaaaatcgccaaggaagagttacttg
aaggtcaagaaatatatagccaagactgagaaagatgctcagatcaagttgagcctctat
gacccatatgaattccacattgtgaacccgaaccgaaaatctcgggtaggaaacccggct
ggttacaggatcgtaccgggtggtaatgcagcgagtttgcttgatcacgatgatcctcct
caaattcgaggtgcattcactaataatcagatatgggtgactccatataaccggtcagaa
caatatgccggaggagttctaatttaccagagccaaggtgatgacacactacaagtttgg
tcagaccgggaccgttcgatcgaaaacaaggacatagtactgtggtacacactagggttc
catcacgtaccttgtcaagaagattatccagttatgccaaccgttgcggctagctttgaa
cttaaaccagcaaatttctttgaatccaatccgattcttgggtctgctcctttcttcgaa
aaagacttaccggtctgtagaccatttgcttcatcttga

KEGG   Arabidopsis thaliana (thale cress): AT2G42490
Entry
AT2G42490         CDS       T00041                                 
Name
(RefSeq) Copper amine oxidase family protein
  KO
K00276  primary-amine oxidase [EC:1.4.3.21]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00260  Glycine, serine and threonine metabolism
ath00350  Tyrosine metabolism
ath00360  Phenylalanine metabolism
ath00410  beta-Alanine metabolism
ath00950  Isoquinoline alkaloid biosynthesis
ath00960  Tropane, piperidine and pyridine alkaloid biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT2G42490
   00350 Tyrosine metabolism
    AT2G42490
   00360 Phenylalanine metabolism
    AT2G42490
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT2G42490
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    AT2G42490
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    AT2G42490
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.21  primary-amine oxidase
     AT2G42490
SSDB
Motif
Pfam: Cu_amine_oxid Cu_amine_oxidN3 Cu_amine_oxidN2
Other DBs
NCBI-GeneID: 818849
NCBI-ProteinID: NP_181777
TAIR: AT2G42490
UniProt: Q8L866 A0A178VYJ2
Position
2:complement(17691407..17696023)
AA seq 776 aa
MASASKKTSACPHHGGSLPPPKLVSAAPDTVAVWSDADDQRASKVSLESVIRPVDSFPDN
TAKKPANKGISVMPRTETKHPLDPLSAAEISVAVATVRAAGANPEVRDGMRFIEVASVEP
DKQVVALADAYFFPPFQPSLLPRTKSGPVIPMKLPPRRARLVVYNQKSNETSVWIVALSE
VHAVTRGGHHRGRVVSSQVIPDVQPPMDAAEYAECEAIVKDFPPFIEAMKRRGIEDMDLV
MVDPWCVGYHSEADAPSRRLAKPLIYCRTDSDSPMENGYARPVEGIYVLVDMQNMVVIEF
EDRKFVPLPPPDPLRNYTPGESRGGVDRSDVKPLQIIQPEGPSFRVRGYFVEWQKWNFRI
GFTPREGLVIHSVAYVDGSRGRRPVAHRLSFVEMVVPYGDPNEPHYRKNAFDAGEDGLGK
NAHSLKKGCDCLGSIKYFDAHFTNFTGGVETIENCVCLHEEDHGILWKHQDWRTGLAEVR
RSRRLTVSFLCTVANYEYGFYWHFYQDGKIEAEVKLTGILSLGALQPGETRKYGTTIAPG
LYAPVHQHFFIARMDMSVDCKPAEAFNQVVEVNVRVDERGENNVHNNAFYAEEKLLKSEA
VAMRDCDPLSARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNL
WVTRYAPDEKFPGGEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGITHVPRLEDWP
VMPVEHIGFTLMPHGFFNCSPAVDVPPNPCELETKESEVKEVVAPKALQTGLLSKL
NT seq 2331 nt   +upstreamnt  +downstreamnt
atggcctcagcttcgaaaaagacgtcggcatgtcctcaccacggtggctctcttccgcct
cccaaactcgtctccgctgctcccgataccgttgctgtatggtccgacgctgacgatcag
cgagcctctaaagtttctttggaatccgttatccgccctgtcgattcgtttcctgataat
actgccaagaaacctgccaacaaagggatttctgtgatgccaaggactgaaaccaagcac
ccattggatcctctttctgctgcagaaatatcagttgctgtggcgactgttcgcgcagct
ggtgccaatcctgaggttagggatggcatgcgtttcattgaggtggcatcagtggaacca
gataaacaagttgtggcgctcgctgatgcttactttttcccaccgttccagccatcacta
cttccaagaactaaatctggacctgtgattccgatgaagctccctccaaggcgagctaga
cttgttgtttacaaccaaaagtctaatgagacaagtgtatggattgtggcattgtctgaa
gttcatgctgtcactcggggtggacatcacaggggaagagttgtttcctcacaagttata
cctgatgttcagccacccatggatgcggctgaatatgctgaatgtgaagcgattgtcaaa
gacttcccaccattcatagaggcaatgaagaggagaggtattgaagacatggatctagtg
atggttgatccctggtgtgtgggttatcacagtgaggctgacgctcctagtcgtaggctt
gcaaagccccttatatactgtcggactgatagtgattcccctatggaaaatggatatgct
cgtccagttgagggcatttatgtacttgtagacatgcaaaacatggtggtgattgaattt
gaagaccgtaagtttgtgccactccccccacctgaccctttgaggaattataccccaggt
gaaagtagagggggtgttgatagaagtgatgttaagcctctccagattattcagcctgaa
ggtccaagttttcgtgtaaggggttactttgtcgagtggcagaagtggaactttcgtatt
ggattcactccaagggaaggtttagtcatacattcggtagcatatgttgatggcagtcga
ggtcgaaggcctgttgcacacaggctaagttttgtggaaatggttgtgccttatggcgat
cctaatgagccacattacaggaaaaatgcttttgatgcaggggaggatggtctcgggaaa
aacgcacattcgcttaagaaggggtgtgactgtctgggatctatcaagtacttcgatgcc
catttcacaaatttcactggaggagttgaaacaattgagaactgtgtttgcttgcatgaa
gaagatcatgggattttgtggaaacatcaggactggagaacaggattagccgaagtgcga
agatctaggagactaactgtctcttttctatgtactgttgccaactacgagtatgggttt
tactggcacttctaccaggatgggaaaatcgaagctgaagtaaaacttactggtatcctc
agtttaggagctctgcagccaggtgaaactcgaaagtacggtactactattgctcctggg
ttgtatgcaccagtccatcaacatttctttatcgctcgcatggatatgtctgttgactgt
aaacctgctgaagcttttaatcaggtagttgaggtaaatgttagagttgacgagcgaggt
gagaacaatgtccacaacaatgcgttttatgcggaagagaagttacttaaatctgaggca
gtggcgatgcgtgactgtgaccctctttctgctcgccattggattgtaaggaacacaagg
actgtaaacaggacgggccaattaacgggatacaaacttgttccgggttcaaattgtttg
ccattagctcgacccgaggcgaagtttctaagaagagccgctttcctgaagcataatctc
tgggttacccgttacgccccagacgagaagtttcctggaggagaattcccaaaccaaaac
ccacgggctggtgaaggtcttgccacatgggtgaaacagaatcgctccttggaagaatct
gacgtcgttctttggtacgtgtttgggatcacacatgttcctagacttgaagattggccg
gttatgcccgtcgaacatattggtttcacactaatgccacatggatttttcaactgctca
ccggcagtagatgtgccaccgaatccatgcgaattggagactaaggagagtgaagtcaaa
gaggttgtagcaccgaaagctcttcagactggtttactttcaaagctttga

KEGG   Arabidopsis thaliana (thale cress): AT3G43670
Entry
AT3G43670         CDS       T00041                                 
Name
(RefSeq) Copper amine oxidase family protein
  KO
K00276  primary-amine oxidase [EC:1.4.3.21]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00260  Glycine, serine and threonine metabolism
ath00350  Tyrosine metabolism
ath00360  Phenylalanine metabolism
ath00410  beta-Alanine metabolism
ath00950  Isoquinoline alkaloid biosynthesis
ath00960  Tropane, piperidine and pyridine alkaloid biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT3G43670
   00350 Tyrosine metabolism
    AT3G43670
   00360 Phenylalanine metabolism
    AT3G43670
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT3G43670
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    AT3G43670
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    AT3G43670
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.21  primary-amine oxidase
     AT3G43670
SSDB
Motif
Pfam: Cu_amine_oxid Cu_amine_oxidN3 Cu_amine_oxidN2
Other DBs
NCBI-GeneID: 823469
NCBI-ProteinID: NP_189953
TAIR: AT3G43670
UniProt: Q9M2B9
Position
3:15567067..15569984
AA seq 687 aa
MVELSFSQLLVLLLSLLFLFTTLASSSKTPRFKYSLEKPHHPLDPLTTPEIKRVQTILSG
HDPGFGSGSTIIHAMALDEPDKQRVIRWKKGDRLPPRRAEILAMSNGESHVLTVDLKSGR
VVSDLVNPTFGYPILTMKDIIAVSQVPYKSVEFNRSIEARGIPFSGLICITPFAGWYGPD
EEGRRVIKIQCFSKQDTVNFYMRPIEGLYLTVDMDKLEIIKIVDNGPVPVPKSTGTEYRY
GFLNETVYMDRVNPMSMEQPDGPSFQVEDGYLVKWANWKFHIKPDQRAGMIISQATVRDS
KTGEARSVMYKGFASELFVPNMDPGEGWYSKAYMDAGEFGLGPSSMPLVPLNDCPRNAYY
IDGFFASPEGIPILQPNMICLFERYAGDTSWRHSEILLPGVDIRESRAKVTLVARMACSV
GNYDYIFDWEFQMDGVIRVTVAASGMLMVKGTAYENVEDLGEKEDDSGPLISENVIGVVH
DHFISFHLDMDIDGSANNSFVKVHLEKQRLPPGESRRKSYLKVKKYVAKTEKDAQIKMSL
YDPYEFHLVNPNRLSRLGNPAGYKLVPGGNAASLLDHDDPPQMRGAFTNNQIWVTRYNRS
EQWAGGLLMYQSRGEDTLQVWSDRDRSIENKDIVLWYTLGFHHVPCQEDFPVMPTIASSF
ELKPVNFFESNPVLGISPFFEKDLPVC
NT seq 2064 nt   +upstreamnt  +downstreamnt
atggtggaactttcgttctctcagctccttgtcttacttttaagcttactctttctcttc
actactctcgcgtcaagttccaagaccccccgattcaagtattcgttagagaagcctcac
cacccacttgacccactaacgacacctgaaataaagagagtccaaaccatcctctcgggt
catgatccgggtttcgggtccgggtcaaccatcattcacgccatggctctcgacgagccg
gataagcaacgtgtcatccggtggaagaaaggtgatcgtctcccgccgcgaagagcggag
attcttgctatgtctaacggcgagagtcacgtgctcacggtggatcttaaatccggtcgg
gttgtttctgatttggtcaacccgacttttggatacccgattcttactatgaaggatatc
atcgcagtctcacaggttccttacaagagcgtggagttcaatcgctcaatcgaagcgcgt
gggattccgttctccggtttgatttgtattacaccgttcgccggttggtatggaccggac
gaagaaggacgacgagtcataaagatccaatgtttctcaaagcaagacactgtcaatttc
tacatgagacctatcgaaggactttatttaaccgtcgatatggataaattagagatcatc
aagattgtagacaatggaccggttccggttcccaagtctaccggtacggaatatagatat
gggtttcttaatgaaacggtatatatggaccgtgtcaacccaatgtcgatggagcaaccg
gacggtccaagttttcaagttgaggatggatacttggttaagtgggcgaattggaaattt
catattaaaccggatcaacgtgccggtatgattatctcacaggctacagttcgtgattcc
aagacaggtgaagcaagaagtgtaatgtacaaaggttttgcgtcggagttgttcgtaccg
aatatggatccaggggaaggttggtattcaaaagcttacatggatgctggagagtttggt
ttaggaccttcttcaatgccacttgtgccactcaacgactgtcctcgaaacgcttactac
attgatggtttcttcgcttctcctgaaggcattccaatacttcaacctaacatgatctgc
ttgttcgaacgctacgcgggtgacactagctggcgacactctgagattcttctccctggt
gtagatataagagagtcaagggcaaaggttacactggtagctagaatggcatgttctgtt
gggaactatgattatatttttgattgggagtttcaaatggatggtgtgattcgtgttacg
gtcgcggcctcggggatgttgatggtgaaaggaacggcttacgaaaacgttgaagacttg
ggtgagaaagaggatgattctggaccgttgatctcagaaaacgttataggagtcgtccat
gatcatttcatatcgtttcatctagacatggacattgatgggtcagccaacaactccttc
gttaaggttcatctagagaagcagagacttccacctggagaatcaaggagaaagagttac
ttgaaggtcaagaaatatgtagccaagactgagaaagatgctcagatcaagatgagcctg
tacgacccctacgagttccatcttgtgaaccctaaccgactttctcggttagggaacccg
gctggttacaagcttgtacctggtggtaatgctgcaagtttgctcgatcatgatgatcca
ccgcaaatgcgaggcgctttcacaaacaatcagatatgggtgactcggtataaccggtca
gagcaatgggctggagggcttttgatgtaccagagccgtggtgaagacacactacaagtt
tggtccgacagagatcggtccattgagaacaaggacatagtgttgtggtatacactaggg
ttccatcacgtaccgtgccaagaagattttccagtgatgccaacaatagcatctagcttt
gaacttaaaccggtcaatttcttcgaatcgaacccggtacttgggatttcacctttcttc
gagaaagacttaccagtctgttaa

KEGG   Arabidopsis thaliana (thale cress): AT4G12290
Entry
AT4G12290         CDS       T00041                                 
Name
(RefSeq) Copper amine oxidase family protein
  KO
K00276  primary-amine oxidase [EC:1.4.3.21]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00260  Glycine, serine and threonine metabolism
ath00350  Tyrosine metabolism
ath00360  Phenylalanine metabolism
ath00410  beta-Alanine metabolism
ath00950  Isoquinoline alkaloid biosynthesis
ath00960  Tropane, piperidine and pyridine alkaloid biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT4G12290
   00350 Tyrosine metabolism
    AT4G12290
   00360 Phenylalanine metabolism
    AT4G12290
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT4G12290
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    AT4G12290
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    AT4G12290
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.21  primary-amine oxidase
     AT4G12290
SSDB
Motif
Pfam: Cu_amine_oxid Cu_amine_oxidN3 Cu_amine_oxidN2
Other DBs
NCBI-GeneID: 826838
NCBI-ProteinID: NP_001329903
TAIR: AT4G12290
UniProt: A0A1P8B956
Position
4:7303985..7307237
AA seq 671 aa
MDQKSFFRLIFLIVTAGFIISFTSTNFPHAPTRLLDCTDSSSSPLCASRNFLFNKQQPRP
IPKHDPKPNTKNHDHVSDTPNHPLDPLTVSEINKIRSILSSHALFTSGTPHALHTVVLEE
PEKNLVRHWEKGNPLPPRKASVIARVGADTHVLTVDISTGRVDSENSPVRVSGYPMMTIE
EMNDITVVPFSNADFNRTIISRGVNLTDVICFPISCGWFGNKEENARVIKSQCFMTQGTP
NFYMRPIEGLTILIDLDTKQVIEITDTGRAIPIPGSTNTDYRFQKLATTDKTRPLNPISI
EQPRGPSFVIEDNHLVKWANWEFHLKPDPRAGVVISRVRVHDPDTHETRDVMYKGFVSEL
FVPYMDPSDAWYFKTYMDAGEYGFGLQAMPLVPLNDCPRNAAYMDGVFAAADGTPFVREN
MVCIFESYAGDIGWRHSESPITGIPIREVRPKVTLVVRMAASVGNYDYIIDYEFQTDGLI
KAKVGLSGILMVKGTTYQNKNQVEKDKDGNEEELHGTLLSENVIGVIHDHYVTFYLDLDV
DGPDNSFVKVNLKRQETEPGESPRKSYLKAVRNIAKTEKDGQIKLSLYDPSEFHVINSGK
TTRVGNPTGYKVVPRTTAASLLDHDDPPQKRGAFTNNQIWVTPYNKSEQWAGGLFTYQSH
GDDTLAVWSDR
NT seq 2016 nt   +upstreamnt  +downstreamnt
atggaccaaaaaagctttttccggttgatttttctcatagtcacagctggtttcatcatc
tccttcacttccactaacttccctcacgcgccgacgaggcttcttgattgcaccgactct
tcttcttcacctctttgcgcttcgagaaactttcttttcaacaaacaacaaccacgacct
attcctaaacatgatcctaaaccaaataccaaaaaccatgatcacgtgtccgatacacca
aaccatcctctagacccactcacggtgtcggagattaacaaaatccgatcaatactctct
tctcacgcgctattcacttccggtacaccacacgcgctccacaccgtcgttcttgaagag
cctgagaagaatcttgtccgtcactgggaaaaagggaacccacttcctccgaggaaagct
tccgtcatcgcacgtgttggcgcggacacgcacgtgctcaccgttgatatctctacgggt
cgggtagattcagagaatagcccggttcgtgtttctggttacccgatgatgactatagaa
gagatgaacgatatcactgttgtaccattttcaaacgcggatttcaaccgtacgatcatc
tctcgtggagttaatctaacggacgtgatttgtttcccaatctcttgtggttggtttggt
aataaagaagaaaacgcgagggtaattaaaagtcagtgtttcatgacacaaggaacacct
aacttctacatgcgtcctatcgaaggtttaaccattctcatcgatttagatacaaagcaa
gtgatcgagataaccgatacaggtcgggctatacccatacccggttcaaccaataccgat
taccgcttccaaaagctcgcaaccaccgacaaaactcggcctctaaacccgatatccatt
gagcagccacgtggtccaagcttcgtgatagaggacaaccatctagtgaaatgggcaaat
tgggaatttcatctaaaacctgacccgagagcaggtgtggtaatatcacgggtaagagta
cacgacccggatactcatgagacacgtgacgtgatgtacaaaggtttcgtgtctgaactt
tttgttccgtacatggatccatcggacgcgtggtactttaagacttacatggacgcaggg
gaatacgggttcgggttacaagccatgccactcgtaccgcttaatgattgtccacgaaac
gcagcctatatggacggagttttcgccgcagccgatggaacaccgttcgtgagagaaaac
atggtttgtatctttgagagttacgccggagatattgggtggcgtcactccgaaagcccc
atcaccggtataccgataagggaagtgagaccaaaagtgacgctagtggtacgaatggca
gcttcggtaggtaactatgattacatcattgattacgagttccaaactgatgggcttata
aaagctaaggtcgggctaagtggaatactaatggtgaaagggacaacatatcaaaacaaa
aaccaagtggagaaagataaagacggtaatgaagaagagcttcacggcacgcttctgtct
gaaaatgtaattggagtaatacacgatcactacgtcactttttaccttgaccttgacgtc
gatggcccggacaactcatttgttaaagtgaatctcaagaggcaagagaccgagccaggc
gagtcaccgaggaaaagttacctaaaagctgttaggaacattgcgaaaaccgaaaaggat
ggtcagatcaagcttagcttgtacgatccatcagaattccacgtcatcaactctggtaaa
accactcgggtcggaaacccgacgggttataaggtcgttcctagaacgacggcagctagt
ctacttgaccatgatgatccgccgcagaagagaggagcttttaccaacaaccaaatttgg
gtcactccgtacaataagtcggagcaatgggctggtggcttgttcacttaccaaagccat
ggtgatgacactcttgcagtttggtcagacaggtga

KEGG   Arabidopsis thaliana (thale cress): AT4G14940
Entry
AT4G14940         CDS       T00041                                 
Symbol
AO1
Name
(RefSeq) amine oxidase 1
  KO
K00276  primary-amine oxidase [EC:1.4.3.21]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00260  Glycine, serine and threonine metabolism
ath00350  Tyrosine metabolism
ath00360  Phenylalanine metabolism
ath00410  beta-Alanine metabolism
ath00950  Isoquinoline alkaloid biosynthesis
ath00960  Tropane, piperidine and pyridine alkaloid biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT4G14940 (AO1)
   00350 Tyrosine metabolism
    AT4G14940 (AO1)
   00360 Phenylalanine metabolism
    AT4G14940 (AO1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT4G14940 (AO1)
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    AT4G14940 (AO1)
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    AT4G14940 (AO1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.21  primary-amine oxidase
     AT4G14940 (AO1)
SSDB
Motif
Pfam: Cu_amine_oxid Cu_amine_oxidN2 Cu_amine_oxidN3
Other DBs
NCBI-GeneID: 827152
NCBI-ProteinID: NP_193230
TAIR: AT4G14940
UniProt: O23349
Position
4:8541879..8544566
AA seq 650 aa
MNTSILAILFLIQCVFTLGLHFHPLDPLTPQEINKTSFIVKKSHLGNLKDLTFHYLDLEE
PNKSHVLQWLSPNPSKKPPPPRRRSFVVVRAGGQTYELIIDLTTSKIASSRIYTGHGFPS
FTFIELFKASKLPLTYPPFKKSILDRSLNISEVSCIPFTVGWYGETTTRRELKASCFYRD
GSVNVFTRPIEGITVTIDVDSMQVIKYSDRFRKPIPDKEGNDFRTKHRPFPFFCNVSDTG
FKILGNRVKWANWKFHVGFTARAGVTISTASVLDPRTKRFRRVMYRGHVSETFVPYMDPT
YEWYYRTFMDIGEFGFGRSAVNLQPLIDCPQNAAFLDGHVAGPDGTAQKMTNVMCVFEKN
GYGASFRHTEINVPGQVITSGEAEISLVVRMVATLGNYDYIVDWEFKKNGAIRVGVDLTG
VLEVKATSYTSNDQITENVYGTLVAKNTIAVNHDHYLTYYLDLDVDGNGNSLVKAKLKTV
RVTEVNKTSSRRKSYWTVVKETAKTEADGRVRLGSDPVELLIVNPNKKTKIGNTVGYRLI
PEHLQATSLLTDDDYPELRAGYTKYPVWVTAYDRSERWAGGFYSDRSRGDDGLAVWSSRN
REIENKDIVMWYNVGFHHIPYQEDFPVMPTLHGGFTLRPSNFFDNDPLIG
NT seq 1953 nt   +upstreamnt  +downstreamnt
atgaacacatcaatacttgccatactttttctcatacaatgtgttttcactcttggtctc
catttccacccacttgatcccttaactccccaagaaatcaacaaaacaagctttatcgtc
aagaaatctcatctaggcaacctcaaagatctcacatttcattatctcgacctcgaagaa
ccaaacaagagccacgtcctccaatggctatcaccaaatccctccaagaaaccaccaccc
ccacgtcgtcgctcattcgtcgtggttcgagccggtggtcaaacctacgagctcatcatc
gacctaaccacgagcaagattgcatcctcccgcatctacacaggccatggtttcccctca
ttcacattcatagagcttttcaaagcaagcaagcttcctctaacttacccacctttcaag
aaatcgattctcgatcgatccctaaacatctccgaggtttcttgcatccctttcaccgtt
ggttggtacggagaaaccaccacgagacgtgaactcaaagcctcttgcttttacagagac
ggatcagtcaacgtcttcacaagacccatcgaaggaatcaccgtaactatagacgtcgac
tcaatgcaagtcatcaagtactccgacagattccgaaagcctatccctgataaagaaggt
aacgactttaggactaaacacagacccttcccgttcttttgcaacgtctccgacacaggc
ttcaagatactcggcaatagagtcaagtgggctaactggaaattccacgtcggatttacc
gcaagagcgggagtaactatatcgacggcttcggttcttgacccgagaaccaaaaggttt
cgacgagtgatgtatagagggcacgtgtcagagacttttgttccgtacatggacccaacc
tacgaatggtactaccgtacgttcatggacattggagagtttggtttcgggagatccgcc
gtgaatctgcagccactcattgactgcccgcaaaacgctgcgtttttagatgggcacgtg
gccggaccagatgggacagctcagaagatgaccaatgtgatgtgtgtattcgagaaaaac
ggttacggtgcttcttttagacacaccgagattaatgttccaggacaagtgataacaagt
ggggaagctgaaataagtttagtggttagaatggtggccacacttggaaactatgattac
atagtggattgggaatttaaaaagaatggagccatcagagttggggtggatttgactgga
gttttagaagtaaaagcgacatcgtacacttcaaacgatcaaataacggagaacgtatac
ggtacactggtggcgaagaacactatcgccgttaaccacgaccattacctaacgtactac
ttggacctcgacgttgacggtaacggcaattccttggtgaaagccaaactcaaaacggta
agagtaacggaagttaacaaaacgtcttctcggaggaagagttactggacggtcgttaaa
gagacggcgaaaacggaagctgacggtagagttcgactcggctcggatccggttgagctg
ttaatagtaaacccgaacaagaagacgaaaataggaaatacagttggttaccggctgata
ccggaacatttacaagccacttcgcttttaaccgatgatgattaccccgagttaagagcc
ggttacacgaaatatccggtttgggtgaccgcctatgaccggtccgagagatgggccggt
gggttttatagtgatcggagccgtggcgatgacggtttagctgtatggagtagtaggaac
agagagatagagaacaaagacatagtgatgtggtacaacgttgggtttcatcacattcca
taccaagaggattttccggttatgccaactcttcacggtggttttactcttcggccttca
aatttcttcgataacgatcctttgattgggtaa

DBGET integrated database retrieval system