KEGG   Arabidopsis thaliana (thale cress): AT1G48605
Entry
AT1G48605         CDS       T00041                                 
Symbol
ATHAL3B
Name
(RefSeq) Flavoprotein
  KO
K01598  phosphopantothenoylcysteine decarboxylase [EC:4.1.1.36]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00770  Pantothenate and CoA biosynthesis
ath01100  Metabolic pathways
ath01240  Biosynthesis of cofactors
Module
ath_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT1G48605 (ATHAL3B)
Enzymes [BR:ath01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     AT1G48605 (ATHAL3B)
SSDB
Motif
Pfam: Flavoprotein
Other DBs
NCBI-GeneID: 2745818
NCBI-ProteinID: NP_973994
TAIR: AT1G48605
UniProt: P94063 A0A5S9WPZ3
Position
1:complement(17969395..17970551)
AA seq 201 aa
MNMEVDTVTRKPRILLAASGSVASIKFSNLCHCFSEWAEVKAVASKSSLNFVDKPSLPQN
VTLYTDEDEWSSWNKIGDPVLHIELRRWADVMIIAPLSANTLAKIAGGLCDNLLTCIVRA
WDYSKPLFVAPAMNTLMWNNPFTERHLVLLDELGITLIPPIKKKLACGDYGNGAMAEPSL
IYSTVRLFWESQARKQRDGTS
NT seq 606 nt   +upstreamnt  +downstreamnt
atgaatatggaagtggatacagtaacaaggaagcctcgtatcttactagctgcaagtgga
agtgtggcttcaattaagttcagtaatctctgccattgtttctcagaatgggctgaagtc
aaagccgtcgcttcaaaatcatctctcaatttcgttgataaaccttctctacctcagaat
gtgactctctatacagatgaagatgaatggtctagctggaacaagattggtgatcccgtt
cttcatatcgagctcagacgctgggctgatgttatgatcattgctcctttgtctgctaac
acattagccaagattgctggtgggttatgtgataatctattgacatgtatagtaagagca
tgggattatagcaaaccgttgtttgttgcaccggcgatgaacactttgatgtggaacaat
cctttcacagaacggcaccttgtcttgcttgatgaacttggaatcaccctaattcctccc
atcaagaagaaactggcctgtggagactacggtaatggcgcaatggctgagccttctctg
atttattccactgttagactgttctgggagtcacaagctcgtaaacaaagagatggaacc
agttga

KEGG   Arabidopsis thaliana (thale cress): AT3G18030
Entry
AT3G18030         CDS       T00041                                 
Symbol
HAL3A
Name
(RefSeq) HAL3-like protein A
  KO
K01598  phosphopantothenoylcysteine decarboxylase [EC:4.1.1.36]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00770  Pantothenate and CoA biosynthesis
ath01100  Metabolic pathways
ath01240  Biosynthesis of cofactors
Module
ath_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT3G18030 (HAL3A)
Enzymes [BR:ath01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     AT3G18030 (HAL3A)
SSDB
Motif
Pfam: Flavoprotein
Other DBs
NCBI-GeneID: 821327
NCBI-ProteinID: NP_188430
TAIR: AT3G18030
UniProt: Q9SWE5 A0A654FA54
Structure
Position
3:complement(6167640..6168966)
AA seq 209 aa
MENGKRDRQDMEVNTTPRKPRVLLAASGSVAAIKFGNLCHCFTEWAEVRAVVTKSSLHFL
DKLSLPQEVTLYTDEDEWSSWNKIGDPVLHIELRRWADVLVIAPLSANTLGKIAGGLCDN
LLTCIIRAWDYTKPLFVAPAMNTLMWNNPFTERHLLSLDELGITLIPPIKKRLACGDYGN
GAMAEPSLIYSTVRLFWESQAHQQTGGTS
NT seq 630 nt   +upstreamnt  +downstreamnt
atggagaatgggaaaagagacagacaagacatggaagtgaataccacaccgaggaagcct
cgtgtactactcgctgcaagtggaagcgtcgctgctatcaaattcggcaatctctgccat
tgcttcaccgaatgggcagaagtcagagccgtcgttacgaaatcatctctacatttcctc
gataaactctctctcccacaagaagtgactctgtatactgatgaagatgaatggtctagc
tggaacaagatcggtgatcctgtccttcacatcgagcttagacgttgggctgatgtttta
gtcattgctcctttgtctgctaacaccttaggcaagattgctggtgggctttgtgataat
cttctgacttgcattatacgagcttgggactataccaaaccactgtttgttgctccagct
atgaatactttgatgtggaacaatcctttcactgaaaggcatcttttgtctcttgatgaa
ctgggaatcacacttattcctcctatcaagaagagacttgcctgtggagactacggtaat
ggagctatggctgagccctctcttatctattccactgtcagactcttctgggagtctcag
gctcatcagcaaaccggtggaactagttaa

DBGET integrated database retrieval system