KEGG   Arabidopsis thaliana (thale cress): AT1G53690
Entry
AT1G53690         CDS       T00041                                 
Name
(RefSeq) DNA directed RNA polymerase, 7 kDa subunit
  KO
K03009  DNA-directed RNA polymerases I, II, and III subunit RPABC4
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT1G53690
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT1G53690
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT1G53690
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     AT1G53690
  RNA polymerase III system
   RNA polymerase III
     AT1G53690
  RNA polymerase I system
   RNA polymerase I
     AT1G53690
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      AT1G53690
SSDB
Motif
Pfam: DNA_RNApol_7kD A2L_zn_ribbon OrfB_Zn_ribbon HVO_2753_ZBP zinc_ribbon_13 FtrD-like
Other DBs
NCBI-GeneID: 841806
NCBI-ProteinID: NP_001319215
TAIR: AT1G53690
UniProt: A0A1P8AV79 A0A384LER3
Position
1:complement(20042452..20043626)
AA seq 60 aa
MDLQQSETDDKQPEQLVIYVCGDCGQENILKRGDVFQCRDCGFRILYKKRILDKKETRIV
NT seq 183 nt   +upstreamnt  +downstreamnt
atggatctacaacagtccgaaacagatgataaacagcccgaacaactagttatttacgtc
tgcggagattgtggacaagagaacattttgaagcgtggagatgtgttccaatgcagagat
tgtgggttccgtattctctacaagaagcgtattctcgacaagaaggaaacccgtatagtt
taa

KEGG   Arabidopsis thaliana (thale cress): AT5G41010
Entry
AT5G41010         CDS       T00041                                 
Symbol
NRPB12
Name
(RefSeq) DNA directed RNA polymerase, 7 kDa subunit
  KO
K03009  DNA-directed RNA polymerases I, II, and III subunit RPABC4
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT5G41010 (NRPB12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT5G41010 (NRPB12)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT5G41010 (NRPB12)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     AT5G41010 (NRPB12)
  RNA polymerase III system
   RNA polymerase III
     AT5G41010 (NRPB12)
  RNA polymerase I system
   RNA polymerase I
     AT5G41010 (NRPB12)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      AT5G41010 (NRPB12)
SSDB
Motif
Pfam: DNA_RNApol_7kD DUF5816 YjdM_Zn_Ribbon HypA zf-ribbon_3 DUF1451 zinc_ribbon_13 zinc_ribbon_10 DZR zf-trcl OrfB_Zn_ribbon Zn-ribbon_8 A2L_zn_ribbon PHD Prok-RING_1
Other DBs
NCBI-GeneID: 834103
NCBI-ProteinID: NP_198917
TAIR: AT5G41010
UniProt: Q9FLM8 A0A654G6Z4
Structure
Position
5:16423919..16425324
AA seq 51 aa
MDPAPEPVTYVCGDCGQENTLKSGDVIQCRECGYRILYKKRTRRVVQYEAR
NT seq 156 nt   +upstreamnt  +downstreamnt
atggatccagcgcccgaacccgttacttacgtctgcggagattgtggtcaagagaacact
ttgaagtctggggatgtgatccaatgcagagagtgtgggtaccgtattctctacaagaag
cgtacccgtagagttgttcaatacgaagctcgctga

DBGET integrated database retrieval system