KEGG   Arabidopsis thaliana (thale cress): AT1G54250
Entry
AT1G54250         CDS       T00041                                 
Symbol
NRPB8A
Name
(RefSeq) RNA polymerase Rpb8
  KO
K03016  DNA-directed RNA polymerases I, II, and III subunit RPABC3
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT1G54250 (NRPB8A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT1G54250 (NRPB8A)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT1G54250 (NRPB8A)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     AT1G54250 (NRPB8A)
  RNA polymerase III system
   RNA polymerase III
     AT1G54250 (NRPB8A)
  RNA polymerase I system
   RNA polymerase I
     AT1G54250 (NRPB8A)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      AT1G54250 (NRPB8A)
SSDB
Motif
Pfam: RNA_pol_Rpb8
Other DBs
NCBI-GeneID: 841866
NCBI-ProteinID: NP_175827
TAIR: AT1G54250
UniProt: O81097 A0A178WK20
Position
1:20254938..20256688
AA seq 146 aa
MASNIILFEDIFVVDQLDPDGKKFDKVTRVQATSHNLEMFMHLDVNTEVYPLAVGDKFTL
ALAPTLNLDGTPDTGYFTPGAKKTLADKYEYIMHGKLYKISERDGKTPKAELYVSFGGLL
MLLKGDPAHISHFELDQRLFLLMRKL
NT seq 441 nt   +upstreamnt  +downstreamnt
atggcgagcaatatcatcttgttcgaggatatcttcgtggtcgatcagttagaccctgat
ggcaaaaagttcgataaagttactcgcgttcaagctacgagccacaacttggaaatgttt
atgcatttagatgttaatacagaggtttatccattggctgttggtgataagttcacactt
gcgttggctcctacgctgaatctcgatggaacccctgataccggttattttactccggga
gcaaagaaaacacttgccgataagtatgaatacataatgcacgggaagctttacaagatc
tctgagcgtgacggcaaaactccaaaagcagagctatatgtttcgtttggcggcctcctg
atgttgcttaagggagatccagctcacatttctcacttcgaactcgaccagaggctcttc
ctactcatgaggaagctgtga

KEGG   Arabidopsis thaliana (thale cress): AT3G59600
Entry
AT3G59600         CDS       T00041                                 
Symbol
NRPB8B
Name
(RefSeq) RNA polymerase Rpb8
  KO
K03016  DNA-directed RNA polymerases I, II, and III subunit RPABC3
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT3G59600 (NRPB8B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT3G59600 (NRPB8B)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT3G59600 (NRPB8B)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     AT3G59600 (NRPB8B)
  RNA polymerase III system
   RNA polymerase III
     AT3G59600 (NRPB8B)
  RNA polymerase I system
   RNA polymerase I
     AT3G59600 (NRPB8B)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      AT3G59600 (NRPB8B)
SSDB
Motif
Pfam: RNA_pol_Rpb8
Other DBs
NCBI-GeneID: 825129
NCBI-ProteinID: NP_191519
TAIR: AT3G59600
UniProt: Q9M1A8 A0A5S9XMH3
Structure
Position
3:22016376..22018361
AA seq 146 aa
MASNIIMFEDIFVVDKLDPDGKKFDKVTRVEARSHNLEMFMHLDVNTEVYPLAVGDKFTL
AMAPTLNLDGTPDTGYFTPGAKKTLADKYEYIMHGKLYKISERDGKTPKAELYVSFGGLL
MLLQGDPAHISHFELDQRLFLLMRKL
NT seq 441 nt   +upstreamnt  +downstreamnt
atggcgagcaatattatcatgttcgaggatatcttcgtggtcgataagctagaccctgat
ggcaaaaagttcgataaagttacgcgtgttgaagcaaggagccacaacttggaaatgttt
atgcatttagatgttaacactgaggtttatccattggctgttggtgataagttcacgctg
gctatggctcccacgcttaatctcgatggaactcctgataccggatactttactccggga
gcaaagaaaacacttgcagataagtatgaatacatcatgcacgggaagctttacaagatc
tctgagcgtgacggcaaaactccaaaagcagagttatatgtttcgttcggggggctcctg
atgttgcttcagggagatccagctcatatttctcacttcgaacttgaccagaggctcttt
ctactcatgaggaagctttga

DBGET integrated database retrieval system