KEGG   Arabidopsis thaliana (thale cress): AT1G60440
Entry
AT1G60440         CDS       T00041                                 
Symbol
PANK1
Name
(RefSeq) pantothenate kinase 1
  KO
K09680  type II pantothenate kinase [EC:2.7.1.33]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00770  Pantothenate and CoA biosynthesis
ath01100  Metabolic pathways
ath01240  Biosynthesis of cofactors
Module
ath_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT1G60440 (PANK1)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.33  pantothenate kinase
     AT1G60440 (PANK1)
SSDB
Motif
Pfam: Fumble
Other DBs
NCBI-GeneID: 842339
NCBI-ProteinID: NP_176247
TAIR: AT1G60440
UniProt: O80765
Position
1:complement(22266416..22269258)
AA seq 383 aa
MDPTQISHLALDIGGTLIKLVYFSANGDYSEESRNGCSVVKGRLCFAKFETRKIDDCLEF
IRFNILHHSGVQQPNGEGHDKLYVKATGGGAFKFADLFKEKLGILFDKEDEMCSLVGGVN
FLLKTVPREAFTYLDGQKKFVEIDHNDLYPYLLVNIGSGVSMIKVDGDGKYERISGTSLG
GGTFLGLGKLLTKCKSFDELLELSHHGNNRVIDMLVGDIYGGTDYSKIGLSSTAIASSFG
KAISDGKELEDYQPEDVARSLLRMISNNIGQIAYLNALRFGLKRIFFGGFFIRGLEYTMD
TISVAVHFWSRGEAKAMFLRHEGFLGALGAFTSYNDQSHNDLKPHHHTVQRAILNCSGHN
FRHIPVTSNLNESETIECSINLV
NT seq 1152 nt   +upstreamnt  +downstreamnt
atggatccgactcaaatctctcatttggctctcgacatcggagggactctgatcaagctt
gtgtatttctctgcaaatggagattatagcgaagagtctcgtaatggttgctctgttgtg
aaaggaaggctttgtttcgctaagtttgagactagaaagattgatgattgtttggagttt
attcgattcaatatccttcatcattccggtgtacagcaaccgaatggcgaaggtcatgat
aaactttatgttaaggccacaggtggtggggcatttaagtttgctgatctctttaaggag
aaacttggtattcttttcgataaggaagatgagatgtgttctcttgttggtggtgttaat
tttctactaaagactgtcccaagggaagcttttacctacttagatggccaaaagaagttt
gtcgagatcgaccataatgatttgtatccatatctactagtcaacatcggttctggcgtt
agcatgatcaaggtcgatggagatggaaaatatgagaggataagtggaacaagccttggc
ggaggcacatttttaggtcttgggaagcttttaacaaaatgcaagagttttgatgagctg
ctagagttaagccaccatggaaataacagagtaattgacatgcttgtgggggatatctac
ggtggaacagattattcaaagattggtctctcctcaacagctatcgcttccagctttggg
aaagcgatttctgatggtaaagaacttgaagattaccagccagaagatgtggcaaggtcc
cttctaagaatgatatcaaataacatcggtcagattgcttatttgaatgctctcagattc
ggtcttaagcgtattttctttggtggatttttcatccgtgggcttgagtacaccatggac
acaatctccgttgctgttcacttttggtcgagaggtgaggcaaaggcaatgtttttacga
catgaagggtttcttggagcattaggcgctttcacgagctacaatgaccagagccataac
gatttaaaaccgcatcatcacactgtgcaaagagcaattctcaactgttcaggtcataac
tttcggcacatcccagtaacttcaaatttaaacgaaagcgagaccatagaatgtagcatc
aatttagtttag

DBGET integrated database retrieval system