KEGG   Arabidopsis thaliana (thale cress): AT1G60620
Entry
AT1G60620         CDS       T00041                                 
Symbol
RPAC43
Name
(RefSeq) RNA polymerase I subunit 43
  KO
K03027  DNA-directed RNA polymerases I and III subunit RPAC1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT1G60620 (RPAC43)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT1G60620 (RPAC43)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     AT1G60620 (RPAC43)
  RNA polymerase I system
   RNA polymerase I
     AT1G60620 (RPAC43)
SSDB
Motif
Pfam: RNA_pol_A_bac RNA_pol_L Fer4_7
Other DBs
NCBI-GeneID: 842356
NCBI-ProteinID: NP_001320426
TAIR: AT1G60620
UniProt: A0A1P8AMT1
Position
1:22330894..22333568
AA seq 320 aa
MGVDNSVRLENFSEDFKVDVISLTETDMVFDMIGVHAGIANAFRRILLAELPSMAIEKVY
VANNTSVIQDEVLAHRLGLIPIAADPRLFEYLSENDQPNEKNTIVFKLHVKCLKGDPRRK
VLTSELKWLPNGSELIKESGGSTTTPKTYTSFNHSQDSFPEFAENPIRPTLKDILIAKLG
PGQEIELEAHAVKGIGKTHAKWSPVATAWYRMLPEVVLLKEFEGKHAEELVKVCPKKVFD
IEDMGQGRKRATVARPRDCSLCRECIRDGVEWEDQVDLRRVKNHFIFTIESTGSQPPEVL
FNEAVKILEDKCERVISELS
NT seq 963 nt   +upstreamnt  +downstreamnt
atgggagtggacaacagtgtgagactagaaaacttctctgaggatttcaaagttgatgtg
attagtctcacagagacagatatggtattcgatatgatcggtgtccatgcaggaatcgct
aatgctttccgaagaatcctcttagctgagcttccttcaatggctattgaaaaagtgtat
gtagcaaacaacacatcggttattcaagacgaagttcttgctcacaggttgggtcttatt
ccaattgccgcagatccgagactctttgaatatttatctgaaaacgatcagccaaatgaa
aagaacaccattgttttcaaactccatgtgaaatgtctaaaaggtgacccgcgtcgtaaa
gtcttaacaagcgaattgaaatggttaccaaatggaagtgagcttatcaaagaatctgga
ggttcaaccacaacgccaaaaacttacacttcattcaaccatagccaagattccttccct
gaatttgctgaaaatcctatcaggccaaccttaaaagatatcttgatagcaaaacttggc
cctggccaggaaatcgagcttgaggctcatgccgttaagggcattggtaaaacacatgca
aagtggtccccagtagcaacggcttggtatcgaatgcttcctgaggtggttctactaaag
gaattcgagggtaaacatgccgaagaactcgtaaaagtctgccccaagaaagtttttgac
attgaagacatgggccaaggtaggaagagggcaacagtagctcggccgcgtgattgttcg
ttgtgtagagaatgcataagagatggagtggaatgggaggaccaagtggatctgcgccgt
gtcaagaaccattttatatttacaattgagtccacgggatcacagcctccggaggttctt
ttcaacgaagcagtgaagatattggaagataaatgtgaaagagtaatctctgaactctcc
tga

KEGG   Arabidopsis thaliana (thale cress): AT1G60850
Entry
AT1G60850         CDS       T00041                                 
Symbol
ATRPAC42
Name
(RefSeq) DNA-directed RNA polymerase family protein
  KO
K03027  DNA-directed RNA polymerases I and III subunit RPAC1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT1G60850 (ATRPAC42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT1G60850 (ATRPAC42)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     AT1G60850 (ATRPAC42)
  RNA polymerase I system
   RNA polymerase I
     AT1G60850 (ATRPAC42)
SSDB
Motif
Pfam: RNA_pol_A_bac RNA_pol_L Fer4_7 Fer4_9
Other DBs
NCBI-GeneID: 842377
NCBI-ProteinID: NP_001320360
TAIR: AT1G60850
UniProt: A0A384LJA0 Q9C6C2
Position
1:complement(22397913..22400413)
AA seq 375 aa
MVTKAEKQFAKNFNIDDLPDVPAGLPPHLKAQQTRVVSKNNAPAHTASAIYSGTYVSSTE
EDDNVKLGNFYDNFKVDVVSLTKTDMEFDMIGIDAAFANAFRRILIAEVPSMAIEKVLIA
YNTSVIIDEVLAHRMGLIPIAADPRLFEYLSEHDQANEKNTIVFKLHVKCPKNRPRLKVL
TSDLKWLPNGSELLRESENKTSKPKTYTSFSCSQDSLPEFANNPITPCDLDILIAKLAPG
QEIELEAHAVKGIGKTHAKWSPVGTAWYRMHPEVVLRGEVEDELAERLVNVCPQNVFDIE
DMGKGKKRATVAQPRKCTLCKECVRDDDLVDHVDLGSVKNHFIFNIESTGSLPPEVLFTE
AVKILEAKCEAITDF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggtgactaaagcagaaaaacaattcgccaaaaatttcaacatagacgatctccctgac
gtccctgccggacttcctccacatctcaaagcccagcaaactcgtgtcgtctctaaaaac
aacgctcctgctcatactgcgagtgccatttactcgggtacctatgtttcttctacggaa
gaggacgacaatgtgaagctaggaaacttctatgataacttcaaagttgatgtggttagt
ctcacaaagacagatatggaatttgatatgattggtattgatgcagcgtttgccaatgca
ttccgaaggatccttatagctgaggttccttcaatggctattgaaaaagtgttgatagcg
tacaacacatcggttattatagacgaagttcttgctcacaggatgggtcttattccaatt
gccgcagatccaagactttttgaatatttatccgaacatgatcaggcgaatgaaaagaac
accattgtattcaaactccatgtgaaatgtccgaaaaatagaccacgtcttaaagtttta
acgagtgatttaaaatggttaccaaatggaagtgagcttctgagagaatcggaaaataaa
acctcaaagccaaaaacttacacttcattcagttgcagccaagattcattacctgaattt
gctaataatcctatcactccatgcgacctcgatatcttgatagcaaaactcgcccctggt
caggaaatcgagctcgaagctcatgcggttaagggcattggtaaaacacatgcaaagtgg
tctccagtagggactgcttggtatagaatgcatcctgaggtggttctacgtggggaagtt
gaggatgaacttgctgaacgacttgtaaacgtctgcccacagaatgttttcgacattgaa
gacatgggaaaaggtaagaaaagggcaacagtagcgcagccacgtaagtgcacattgtgt
aaggaatgcgtaagagacgatgatttggtagaccatgtggatcttggcagtgttaagaac
cattttatatttaacattgagtccaccggatcactgcctccagaggttctcttcactgaa
gctgtgaagatattggaagctaaatgtgaagctataaccgacttttga

DBGET integrated database retrieval system