KEGG   Arabidopsis thaliana (thale cress): AT1G63020
Entry
AT1G63020         CDS       T00041                                 
Symbol
NRPD1A
Name
(RefSeq) nuclear RNA polymerase D1A
  KO
K16250  DNA-directed RNA polymerase IV subunit 1 [EC:2.7.7.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT1G63020 (NRPD1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT1G63020 (NRPD1A)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     AT1G63020 (NRPD1A)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol IV and V specific subunits
     AT1G63020 (NRPD1A)
SSDB
Motif
Pfam: RNA_pol_Rpb1_2 DUF3223 RNA_pol_Rpb1_3 RNA_pol_Rpb1_4 RNA_pol_Rpb1_5 RNA_pol_Rpb1_1
Other DBs
NCBI-GeneID: 842605
NCBI-ProteinID: NP_176490
TAIR: AT1G63020
UniProt: Q9LQ02
Structure
Position
1:complement(23354685..23362589)
AA seq 1453 aa
MEDDCEELQVPVGTLTSIGFSISNNNDRDKMSVLEVEAPNQVTDSRLGLPNPDSVCRTCG
SKDRKVCEGHFGVINFAYSIINPYFLKEVAALLNKICPGCKYIRKKQFQITEDQPERCRY
CTLNTGYPLMKFRVTTKEVFRRSGIVVEVNEESLMKLKKRGVLTLPPDYWSFLPQDSNID
ESCLKPTRRIITHAQVYALLLGIDQRLIKKDIPMFNSLGLTSFPVTPNGYRVTEIVHQFN
GARLIFDERTRIYKKLVGFEGNTLELSSRVMECMQYSRLFSETVSSSKDSANPYQKKSDT
PKLCGLRFMKDVLLGKRSDHTFRTVVVGDPSLKLNEIGIPESIAKRLQVSEHLNQCNKER
LVTSFVPTLLDNKEMHVRRGDRLVAIQVNDLQTGDKIFRSLMDGDTVLMNRPPSIHQHSL
IAMTVRILPTTSVVSLNPICCLPFRGDFDGDCLHGYVPQSIQAKVELDELVALDKQLINR
QNGRNLLSLGQDSLTAAYLVNVEKNCYLNRAQMQQLQMYCPFQLPPPAIIKASPSSTEPQ
WTGMQLFGMLFPPGFDYTYPLNNVVVSNGELLSFSEGSAWLRDGEGNFIERLLKHDKGKV
LDIIYSAQEMLSQWLLMRGLSVSLADLYLSSDLQSRKNLTEEISYGLREAEQVCNKQQLM
VESWRDFLAVNGEDKEEDSVSDLARFCYERQKSATLSELAVSAFKDAYRDVQALAYRYGD
QSNSFLIMSKAGSKGNIGKLVQHSMCIGLQNSAVSLSFGFPRELTCAAWNDPNSPLRGAK
GKDSTTTESYVPYGVIENSFLTGLNPLESFVHSVTSRDSSFSGNADLPGTLSRRLMFFMR
DIYAAYDGTVRNSFGNQLVQFTYETDGPVEDITGEALGSLSACALSEAAYSALDQPISLL
ETSPLLNLKNVLECGSKKGQREQTMSLYLSEYLSKKKHGFEYGSLEIKNHLEKLSFSEIV
STSMIIFSPSSNTKVPLSPWVCHFHISEKVLKRKQLSAESVVSSLNEQYKSRNRELKLDI
VDLDIQNTNHCSSDDQAMKDDNVCITVTVVEASKHSVLELDAIRLVLIPFLLDSPVKGDQ
GIKKVNILWTDRPKAPKRNGNHLAGELYLKVTMYGDRGKRNCWTALLETCLPIMDMIDWG
RSHPDNIRQCCSVYGIDAGRSIFVANLESAVSDTGKEILREHLLLVADSLSVTGEFVALN
AKGWSKQRQVESTPAPFTQACFSSPSQCFLKAAKEGVRDDLQGSIDALAWGKVPGFGTGD
QFEIIISPKVHGFTTPVDVYDLLSSTKTMRRTNSAPKSDKATVQPFGLLHSAFLKDIKVL
DGKGIPMSLLRTIFTWKNIELLSQSLKRILHSYEINELLNERDEGLVKMVLQLHPNSVEK
IGPGVKGIRVAKSKHGDSCCFEVVRIDGTFEDFSYHKCVLGATKIIAPKKMNFYKSKYLK
NGTLESGGFSENP
NT seq 4362 nt   +upstreamnt  +downstreamnt
atggaagacgattgtgaggagcttcaggttcccgtgggaactctaacctcgataggtttt
agcatttcaaacaacaatgatcgagataaaatgtctgtgctagaggttgaagcaccgaat
caggtgactgattctcggctaggattaccgaatccggattctgtctgcagaacctgtggc
agcaaagatcgaaaagtttgcgaagggcatttcggggttataaacttcgcgtactcgata
ataaacccgtatttcctcaaggaggtagctgcgttgttaaacaaaatctgtccggggtgt
aaatacattcgaaaaaagcagtttcagattaccgaagaccagcctgagagatgtagatac
tgcactttgaataccggttatcctctaatgaagtttagggtaactactaaagaagtcttc
aggcgatccggaatcgttgttgaagtaaacgaagagagtctgatgaaactcaagaaacgg
ggagtgttaacattgcctcctgactattggagttttttgccgcaagactctaatatcgac
gagagctgtttgaaaccaacaaggcgaataataacgcatgcacaggtttatgctctgtta
ttagggattgatcagaggctcatcaagaaggatatccctatgttcaactctcttggtctg
acatcttttcctgttacaccaaatggttaccgtgtaaccgaaatagttcatcagttcaac
ggagctcggctaatatttgatgaacggactcggatctacaagaaactagtcggctttgag
ggaaacacacttgaattgagttctcgtgtgatggaatgcatgcaatattccagactcttt
tcggaaactgtgtcttcgagtaaagattccgcaaatccgtaccagaagaagtctgataca
ccaaaactttgcggtctaaggttcatgaaagacgtgctgctcggtaaaagaagtgatcat
acattccggacagtagttgttggtgatccgtccttgaagctcaacgagattggcataccc
gagagtatcgcaaaaaggcttcaagtatcagagcatctcaaccagtgcaataaagaaagg
cttgtcacttcctttgtccccacactgttggacaataaagagatgcatgtgagaagagga
gatagattggtggctattcaagtcaatgacctccaaaccggagacaaaatattccggagt
ttaatggatggagacactgtgctgatgaacagaccgccttcgattcatcagcattcgctt
attgcaatgacagttagaatcctcccaacgacttctgttgtctccttgaacccgatctgc
tgtttgccgttccgtggtgattttgatggagattgtctccacggttacgttcctcagtcc
attcaagcaaaggtcgagcttgatgagcttgttgctttggataagcagcttatcaacaga
cagaatggtcggaacttgctttctttaggacaagatagcttgacggcggcttatctggtc
aatgttgagaagaactgttatcttaatcgagctcagatgcagcagcttcaaatgtattgc
ccatttcagcttcctccgcctgcaattatcaaagcttctccttcgagcactgagcctcaa
tggacgggaatgcagctattcggaatgctgtttcctcccgggtttgactacacttatcct
ctgaataatgtagttgtgagtaacggcgagcttttgtctttctctgaaggatctgcttgg
ctcagagatggagaagggaatttcatcgagagattgctcaaacacgacaaagggaaagtt
cttgatatcatctattccgctcaagaaatgctatctcagtggttgctgatgcgcggtttg
agtgtgtccttggcggatttgtacctttcctctgatctgcagtctcgaaaaaacttgact
gaagagatatcatacgggttgcgggaagctgagcaagtttgcaacaagcaacagctaatg
gttgaatcttggagagatttccttgcagttaatggggaggataaggaagaggattcagta
tcggatttggcccgattctgctatgagagacaaaaatccgctacattaagcgaacttgca
gtcagtgcttttaaggatgcttacagagatgttcaggcactagcatataggtatggtgat
caatccaactcttttttgatcatgtcgaaagccggcagcaaagggaatatcgggaagctg
gttcagcacagcatgtgtatcggtctgcagaattcagcagtttctttgtcctttgggttt
ccgcgtgaactgacttgcgctgcttggaatgacccgaacagtccacttcgtggcgcaaag
ggaaaagacagtaccactactgagtcatatgttccttatggagtcattgagaactcgttt
ctaacgggtctgaatccattggaatcttttgttcattcagttacaagtcgtgacagttca
ttcagtggtaatgctgatctcccggggacactgagcagaagattaatgttcttcatgcgg
gacatatacgctgcttatgatggcactgtgagaaattctttcggaaaccagttagtccag
tttacttatgagactgatggtcccgttgaagatatcacaggtgaggcacttggctcactt
tctgcttgtgcattatctgaggcagcttacagcgcgctggaccagccaatcagccttctt
gaaacttcgccgcttctgaatcttaagaatgtattggagtgtggatcaaagaaaggtcaa
cgagaacagacaatgtctttgtatttgtctgaatacctttcaaagaaaaagcacgggttc
gaatacgggtcacttgagatcaagaaccacttggagaaacttagtttctcagagatcgtt
tcaacatctatgataatattctctccaagttctaacacgaaagtaccgttaagcccgtgg
gtttgccattttcatatctctgagaaagtactgaagcggaaacaactgagcgcagaatcc
gttgtttcatctttaaacgagcagtacaagagcaggaacagagaactgaagcttgatata
gttgacttagatatacaaaacacaaaccactgctcttcagacgatcaggcaatgaaggat
gataacgtttgcatcacggtgactgtagttgaagcctcaaagcactcggttttggaactg
gatgctattcgtctcgttttgatcccttttcttcttgactctcctgtcaaaggtgatcaa
gggatcaaaaaggtgaatattttgtggactgaccgaccaaaagcgccaaaaaggaatggg
aatcatttggcgggtgagctgtacttgaaggttacaatgtatggagatcggggcaaaaga
aactgttggaccgctcttttagaaacctgccttcccatcatggatatgattgactggggc
cgaagccatcctgataatatccgacaatgctgctcagtttatggaatagatgctggacgc
agcattttcgtagcaaatttggagtccgcggtgtcagatactggtaaggagatactaaga
gagcatctgcttctcgtagctgatagtctctctgttacgggagagtttgtggcattaaac
gccaaaggttggagtaaacaaagacaggtcgagtccacgcctgcaccttttactcaagca
tgcttctcaagcccaagtcaatgctttctcaaagctgctaaggaaggtgtcagagacgat
cttcaagggtctatcgacgctttagcttggggaaaagttcctggtttcggaactggagat
cagttcgaaatcatcatttcgccaaaggttcacgggtttactacaccggtagatgtgtat
gaccttttgagtagtacaaagacgatgcgtagaacaaactctgcgcctaaatcagacaaa
gccacggtccagccttttggcttgctacattccgcattcctgaaagatatcaaggtactc
gatgggaaagggattcctatgtcactgcttagaacgatctttacatggaaaaacatcgag
ttgctttcccagtcattgaaacgcattctccacagttacgagatcaatgaactgttgaat
gagagggacgaaggacttgtgaagatggttctgcagttgcaccccaacagtgttgagaaa
attggaccaggcgtcaaaggaatccgggtcgctaaatcgaagcacggagattcttgttgc
ttcgaggttgtaagaatagacgggacattcgaagacttctcataccacaagtgtgtcttg
ggagcaacaaagataattgccccaaagaaaatgaacttctacaagtcaaagtatcttaaa
aatggtacactcgagtccggtggtttctccgaaaacccgtga

DBGET integrated database retrieval system