KEGG   Arabidopsis thaliana (thale cress): AT1G65070
Entry
AT1G65070         CDS       T00041                                 
Name
(RefSeq) DNA mismatch repair protein MutS, type 2
  KO
K07456  DNA mismatch repair protein MutS2
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    AT1G65070
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT1G65070
DNA repair and recombination proteins [BR:ath03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     AT1G65070
SSDB
Motif
Pfam: MutS_V MSSS Smr RNase_Y_N AAA_14 AAA_23
Other DBs
NCBI-GeneID: 842815
NCBI-ProteinID: NP_001185315
TAIR: AT1G65070
UniProt: Q9SS53 A0A178WFQ3
Position
1:complement(24172577..24176356)
AA seq 876 aa
MNTYSPLQLIPTPIHLKSSRAASPSSLRVASPLIIRAASSDDSQSVENQTLEVLEWRALC
NQLSPFASTTMGLSATKNAEIPVGNSPEESRNLLNETSAALAAMEMMKSRGLGLSEIQDL
SDIVERAVSGQLLTVRELCTVRSTLTAATSTFQKLRKAAISDNRVTPLVDILQGCDFKDT
LQQKISFCIDCNMTMILDRASEDLEIIRSERRRNMENLDSLLKKISTKIFLAGGINKPLI
TQRRSRMCVAIRATHKSLLPGGVVLSVSSSRATCFIEPKEAVELNNMEVRHANSEKAEEM
AILSILTSEVVMAQREILHLLDRILELDIAFARASHANWINGVYPNVTSEHTKTPGLAVD
IDSAQHPLLLGSVLGSPNGGDIFPVPVDIKVESSAKVVVISGPNTGGKTALLKTLGLLSL
MSKSGMYLPAKNCPRLPWFDLILADIGDPQSLEQSLSTFSGHISRIRQILDIASENSLVL
LDEICSGTDPSEGVALATSILQYIKNRVNVAVVSTHYGDLSRLKDNEPRFQNAAMEFSME
TLQPTFRVLWGSTGLSNALRVAKSIGFNKRILENAHKWTEKLNPEQDVERKGSLFQSLME
ERNKLKLQATKTAAFHRDLMNLYHELEHESHDLDKRERALLKKETQKVQEDLNSAKSKME
RLVAEFESQLEITQADQYNSLILKTEEAVAEIIEACCPMDPDSLEEEYSDYSPQAGEKVL
VTGLGDKLGTVVEEPGDDDDTVLVQHGKIRVRIKKKDIKPLPRSTSSQTSNRSLRSKRQI
NMKELGSVLQMQSEPVRIQTSKNTLDLRGMRAEEAVHQLDMAISGRDSGSILFIIHGMGA
GIIKELVLERLRKNTRVSRYEQANPMNHGCTVAYIK
NT seq 2631 nt   +upstreamnt  +downstreamnt
atgaacacttattccccactccaactcataccgacgcctattcatctcaaatcctcacgc
gccgcctcaccgtcatcattacgcgtcgcttctccgttaattatacgcgccgcctcctca
gacgactcacagtcagtcgaaaaccaaactctagaagtcctcgaatggcgtgccctctgc
aatcagctctctccgttcgcttccacaaccatgggcctttccgccaccaaaaacgccgaa
attccggtgggaaactcgccggaagaaagcaggaatctccttaacgagacctcagctgca
ttagctgctatggagatgatgaaatcgcgaggattaggtctttctgaaatccaagacttg
tctgatatcgttgagcgtgctgtgtccggtcaattgcttaccgttagagaactctgtacc
gttcgaagcacgttaacggctgctacatcaacgtttcagaaactccgaaaagcagccatt
agtgataacagggttactccacttgtagatatactacagggttgtgatttcaaggataca
ttacagcagaagattagtttttgtatagactgcaacatgactatgattcttgatagagct
agtgaagatttagagattataagatctgaacggaggagaaacatggagaatttggattct
cttttgaagaaaatatcaactaagatttttctagctggggggattaacaagcctttgata
acgcagaggagatcaaggatgtgtgtagctattagagctacacacaaaagtttacttcca
ggtggtgttgttttaagtgttagtagctctagggcaacatgctttatagaaccgaaagag
gcagtggagcttaataatatggaagtgagacatgcgaactccgagaaagctgaggaaatg
gcgattttgagcattttgacatctgaggtggtgatggcgcagagagagatattgcatttg
ttggatagaatattagaacttgacattgcttttgcaagagcatcacatgcaaattggatt
aatggtgtctatcccaacgtaacttcagaacacacaaaaacaccgggcttagctgtagac
attgattctgcgcagcacccgctacttcttggttcagtattaggcagcccaaatggtgga
gacattttccctgtgccagtagacattaaagttgaaagcagtgccaaagtagtcgtcatc
tcgggtccaaacacaggaggaaagaccgctttgttaaagacattgggattattgtctctt
atgtccaagtccgggatgtatttgcctgctaagaactgcccaaggttgccttggtttgat
cttattctggctgacattggagatcctcagtctttggagcaaagtctttcaacctttagt
ggccacatctcacggatacgacagatacttgacattgcttcagaaaattcacttgtctta
ctagacgaaatatgtagtggaactgatccttcagaaggggttgcacttgctactagcatc
ctacagtatattaaaaaccgtgttaatgtggcagttgtatcaacacattacggtgactta
agtcgcttgaaggataatgaacctcgattccaaaatgctgcaatggagttctccatggaa
actttgcagcctacatttcgagtactctggggaagtactggtctatcaaatgcattgaga
gtagctaagtccattggtttcaataaaagaatattagagaatgcgcataagtggacggag
aaattgaatcccgagcaggatgtagagcggaaaggctcactctttcagtcccttatggaa
gaaagaaataaactaaagcttcaggcaactaagactgcagcttttcatagagacttaatg
aacctttaccacgagcttgagcatgagtcgcatgatcttgataaacgtgagagggctctt
ctgaaaaaagaaacgcaaaaggtgcaagaagatctaaactctgctaagtcaaagatggag
agactggtggctgaatttgaaagtcaactagaaatcactcaagctgatcaatacaattcc
ttaatcctgaaaaccgaagaggcagttgcagagattattgaagcttgctgtcctatggat
cctgattccttagaagaagaatacagtgactactcaccacaagctggtgaaaaagttctt
gtaactggactgggagataagttaggtactgtggttgaagaacctggagatgatgatgat
acagttctagtccagcatggtaagataagagtacgcataaagaaaaaggacataaagccc
cttcctcgtagcacaagtagccaaacatccaatcgttctctacgttcgaagagacagata
aacatgaaagagctaggcagtgtgttgcaaatgcaaagcgaaccagtgcggattcaaacg
tcaaagaacacattggatctaagaggaatgcgggcggaagaagcggttcaccagctagac
atggccatctcgggaagagactcgggctcgatcctatttattattcatggaatgggggca
ggcattataaaggagctagtgcttgagaggttaagaaagaacactcgtgtctcaaggtat
gaacaggcaaatcctatgaaccatggatgtacagttgcttacattaaatga

DBGET integrated database retrieval system