KEGG   Arabidopsis thaliana (thale cress): AT1G65840
Entry
AT1G65840         CDS       T00041                                 
Symbol
PAO4
Name
(RefSeq) polyamine oxidase 4
  KO
K17839  polyamine oxidase [EC:1.5.3.17 1.5.3.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00330  Arginine and proline metabolism
ath00410  beta-Alanine metabolism
ath00770  Pantothenate and CoA biosynthesis
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    AT1G65840 (PAO4)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT1G65840 (PAO4)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT1G65840 (PAO4)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.17  non-specific polyamine oxidase
     AT1G65840 (PAO4)
    1.5.3.-
     AT1G65840 (PAO4)
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 Pyr_redox_2 HI0933_like Thi4 Pyr_redox NAD_binding_9 FAD_oxidored Lycopene_cycl Pyr_redox_3 AlaDh_PNT_C FAD_binding_3 HcgC GIDA DUF3841
Other DBs
NCBI-GeneID: 842894
NCBI-ProteinID: NP_176759
TAIR: AT1G65840
UniProt: Q8H191 A0A178WKV9
Position
1:24489758..24493077
AA seq 497 aa
MDKKKNSFPDNLPEGTISELMQKQNNVQPSVIVIGSGISGLAAARNLSEASFKVTVLESR
DRIGGRIHTDYSFGCPVDMGASWLHGVSDENPLAPIIRRLGLTLYRTSGDDSILYDHDLE
SYGLFDMHGNKIPPQLVTKVGDAFKRILEETEKIRDETANDMSVLQGISIVLDRNPELRQ
EGMAYEVLQWYLCRMEAWFAVDANLISLKCWDQDECLSGGHGLMVQGYEPVIRTIAKDLD
IRLNHRVTKVVRTSNNKVIVAVEGGTNFVADAVIITVPIGVLKANLIQFEPELPQWKTSA
ISGLGVGNENKIALRFDRAFWPNVEFLGMVAPTSYACGYFLNLHKATGHPVLVYMAAGNL
AQDLEKLSDEATANFVMLQLKKMFPDAPDPAQYLVTRWGTDPNTLGCYAYDVVGMPEDLY
PRLGEPVDNIFFGGEAVNVEHQGSAHGAFLAGVSASQNCQRYIFERLGAWEKLKLVSLMG
NSDILETATVPLQISRM
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggataagaagaagaattcgtttccagataatcttcctgaaggcacaatctctgagctt
atgcagaagcagaacaatgtgcagccttctgttattgtgattggtagtggtatatcaggt
cttgctgctgctaggaatctctctgaagcatctttcaaggtgactgttcttgaatcacgc
gataggattggtggtcgtatccatacggattattcctttggttgtcctgttgatatggga
gcttcatggttacatggagtctctgatgagaatcccttagctcccattatacgccgttta
ggactgactttataccgaactagcggggatgactccatcttgtatgatcatgatctggag
agttatggactttttgacatgcatgggaataaaattccgccgcagttggttactaaagtt
ggagatgcattcaagagaattctcgaagagacggagaaaataagggatgaaactgccaat
gacatgtctgttcttcaaggaatatctatcgtcttggatagaaatccagaactaaggcaa
gaagggatggcgtacgaagttttacagtggtacttatgtaggatggaggcgtggtttgct
gtagatgcgaatttaatttcactaaaatgttgggatcaggatgaatgtctttcaggtggt
catggtctaatggtgcagggttatgagccagtgatcagaacaattgcaaaagatcttgat
attcgcttgaaccatagggttactaaagttgtaagaacatctaataacaaggtgatagtc
gcagttgaaggcggaaccaattttgttgctgatgctgttattattacggttccaatcggt
gttctcaaggcaaatctaattcaatttgagccagagctcccacaatggaaaacctctgcg
atatcgggtctcggtgtaggcaatgagaataagattgccttgagatttgacagagcgttt
tggcctaatgtggagttcctcgggatggtggcaccgacttcttacgcatgtggctatttt
ctgaatcttcacaaggcaacaggccatccggtgcttgtttatatggctgcagggaatcta
gcacaagacctcgaaaagctatctgatgaagctacagcaaatttcgtgatgctgcaactt
aagaaaatgtttccagacgcacctgacccggctcaatatctagtgacacggtggggaacg
gatccaaatacattggggtgttatgcgtatgacgtagtaggaatgccggaagatctgtac
ccgaggctaggagagccggttgataatattttcttcggaggagaagccgtgaacgtcgag
catcaaggatccgctcacggagctttcttagcaggagtctcggcctcgcagaattgtcaa
aggtatatctttgaacgactcggggcttgggagaaactcaagcttgtttctcttatgggg
aacagtgacattctcgaaactgcaactgtgcctctccaaatctccaggatgtga

KEGG   Arabidopsis thaliana (thale cress): AT2G43020
Entry
AT2G43020         CDS       T00041                                 
Symbol
PAO2
Name
(RefSeq) polyamine oxidase 2
  KO
K17839  polyamine oxidase [EC:1.5.3.17 1.5.3.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00330  Arginine and proline metabolism
ath00410  beta-Alanine metabolism
ath00770  Pantothenate and CoA biosynthesis
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    AT2G43020 (PAO2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT2G43020 (PAO2)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT2G43020 (PAO2)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.17  non-specific polyamine oxidase
     AT2G43020 (PAO2)
    1.5.3.-
     AT2G43020 (PAO2)
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 FAD_binding_2 Pyr_redox_2 DAO HI0933_like NAD_binding_9 Pyr_redox_3 GIDA Pyr_redox FAD_oxidored Thi4 AlaDh_PNT_C FAD_binding_3
Other DBs
NCBI-GeneID: 818904
NCBI-ProteinID: NP_181830
TAIR: AT2G43020
UniProt: Q9SKX5 A0A5S9X6S4
Position
2:17891503..17894635
AA seq 490 aa
MESRKNSDRQMRRANCFSAGERMKTRSPSVIVIGGGFGGISAARTLQDASFQVMVLESRD
RIGGRVHTDYSFGFPVDLGASWLHGVCKENPLAPVIGRLGLPLYRTSGDNSVLYDHDLES
YALFDMDGNQVPQELVTQIGVTFERILEEINKVRDEQDADISISQAFSIVFSRKPELRLE
GLAHNVLQWYVCRMEGWFAADAETISAKCWDQEELLPGGHGLMVRGYRPVINTLAKGLDI
RVGHRVTKIVRRYNGVKVTTENGQTFVADAAVIAVPLGVLKSGTIKFEPKLPEWKQEAIN
DLGVGIENKIILHFEKVFWPKVEFLGVVAETSYGCSYFLNLHKATGHPVLVYMPAGQLAK
DIEKMSDEAAANFAVLQLQRILPDALPPVQYLVSRWGSDVNSMGSYSYDIVGKPHDLYER
LRVPVDNLFFAGEATSSSFPGSVHGAYSTGLMAAEDCRMRVLERYGELDLFQPVMGEEGP
ASVPLLISRL
NT seq 1473 nt   +upstreamnt  +downstreamnt
atggagtccaggaaaaactctgatcgtcaaatgcgtagagctaattgcttttcagctggt
gagaggatgaagacaaggtcgccctccgtgattgtgatcggaggtggtttcggtgggatt
tcagctgctcgcactcttcaggatgcttcctttcaggttatggtactggagtcccgtgac
agaattggtggacgagttcacactgattactcatttggttttcctgttgatcttggtgca
tcatggctgcatggagtatgcaaggagaatcctctcgcaccagttattggaagacttgga
ctgcccttgtatcgtactagcggtgacaattccgtcctgtatgatcatgatctcgagagc
tatgctctgtttgatatggatggcaaccaagttcctcaagaattggtaactcagattggc
gtaacgtttgagcgtattttggaagagatcaataaagtcagggatgagcaggatgctgac
atttcaatttctcaggctttctcaattgtcttttctaggaaacccgagctgaggttagag
gggcttgcacacaacgtacttcaatggtatgtatgccgcatggaaggatggtttgccgca
gatgctgaaaccatctctgcaaagtgttgggaccaggaggaattgttgcctggtggacac
ggtcttatggttagagggtatcgtcctgtcatcaatactctggcgaaaggtcttgatatc
cgagtaggccacagggttactaagattgtcaggcggtacaatggagtgaaggtaacgaca
gaaaacgggcaaacttttgttgcggatgctgcagtcattgctgtccctcttggagtttta
aaatcgggaaccataaagttcgaacctaagctacctgagtggaaacaagaagcaatcaac
gacctaggagtaggtattgagaacaagatcatactacattttgagaaagtcttttggccg
aaagtagagtttctaggagtggtagctgaaacctcctacggttgcagttattttttgaac
ctgcacaaggccacgggtcatccggttctggtttacatgccggctggtcagcttgccaaa
gacattgagaaaatgtctgatgaagcagctgcaaatttcgccgtcttgcaactccagaga
attcttcccgatgcattgcctccggtacagtatctcgtgtcgaggtggggatctgatgtg
aattcaatgggatcttatagctatgatatcgtgggcaaacctcatgatctctacgagagg
cttagggttccagtggataacttattctttgccggtgaagcgacgagctcgagcttcccg
ggctcggttcacggcgcttattcaactggattgatggcagctgaagattgtaggatgcga
gttctggagcggtatggtgagttggatctgttccagcctgtgatgggcgaggaaggacct
gcctctgtacctcttcttatatctcgtctctaa

KEGG   Arabidopsis thaliana (thale cress): AT3G59050
Entry
AT3G59050         CDS       T00041                                 
Symbol
PAO3
Name
(RefSeq) polyamine oxidase 3
  KO
K17839  polyamine oxidase [EC:1.5.3.17 1.5.3.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00330  Arginine and proline metabolism
ath00410  beta-Alanine metabolism
ath00770  Pantothenate and CoA biosynthesis
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    AT3G59050 (PAO3)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT3G59050 (PAO3)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT3G59050 (PAO3)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.17  non-specific polyamine oxidase
     AT3G59050 (PAO3)
    1.5.3.-
     AT3G59050 (PAO3)
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 FAD_binding_2 Pyr_redox_2 DAO HI0933_like Pyr_redox_3 Thi4 GIDA FAD_oxidored NAD_binding_9 Pyr_redox AlaDh_PNT_C FAD_binding_3 Lycopene_cycl Trp_halogenase
Other DBs
NCBI-GeneID: 825074
NCBI-ProteinID: NP_191464
TAIR: AT3G59050
UniProt: Q9LYT1 A0A5S9XM40
Position
3:complement(21824696..21827509)
AA seq 488 aa
MESGGKTNRQLRKAICVSTDEKMKKKRSPSVIVIGGGMAGISAARTLQDASFQVVVLESR
DRIGGRVHTDYSFGFPVDLGASWLHGVCKENPLAAVIGRLGLPLYRTSGDNSVLYDHDLE
SYALFDKAGNQVSQELVTKVGENFEHILEEICKVRDEQDEDMSIAQAFSIVFKRNPELRL
EGLAHNVLQWYLCRMEGWFAADAETISAKCWDQEELLPGGHGLMVRGYRPVINTLSKGLD
IRLSHRITKISRRYSGVKVTTEKGDTFVADAAVIALPLGVLKSGMITFEPKLPQWKQEAI
NDLGVGIENKIILNFDNVFWPNVEFLGVVAETSYGCSYFLNLHKATSHPVLVYMPAGQLA
RDIEKKSDEAAANFAFSQLQKILPDASSPINYLVSRWGSDINSLGSYSYDIVNKPHDLYE
RLRVPLDNLFFAGEATSSSYPGSVHGAYSTGVLAAEDCRMRVLERYGELEHEMEEEAPAS
VPLLISRM
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggagtccggaggcaaaactaatcgtcagctgcgtaaagctatttgcgtctcaacagac
gagaagatgaagaagaagagatcaccttcagtgatagtgattggaggtggtatggctgga
atttcagccgctcgcactcttcaggatgcttcctttcaggttgttgtattggagtctcgt
gacagaattggtggacgagttcacactgattactcatttggttttccagttgatctcggt
gcatcttggttgcatggtgtctgtaaagagaatcctttggctgcagtaattggtagatta
ggattacctctttatcgtactagcggtgacaattcggttttgtatgatcacgatcttgag
agttatgctctgttcgacaaggctggtaaccaagtttctcaagagttggtgacaaaagtt
ggcgaaaattttgagcacattctggaagagatctgtaaagtcagggatgagcaggacgaa
gacatgtcaatagctcaagccttttctattgtatttaagaggaaccctgaattgaggttg
gagggacttgcccataatgtgcttcagtggtacttgtgccgcatggaaggatggtttgct
gctgatgctgaaaccatctcggcaaagtgttgggatcaggaagaactgttgcccggtgga
catggtcttatggttagagggtatcgccctgtaatcaacactctctcgaaaggtcttgat
atacgactaagtcacagaattaccaagatttcaaggcgctacagtggtgtgaaggtgact
acagagaaaggagacacgtttgttgcggatgctgcagtcattgctcttcctctaggagtc
ttaaagtcaggaatgataacattcgaaccaaagcttccacagtggaaacaagaagctatc
aacgatctcggtgttggaatcgagaacaagatcatattgaattttgacaacgtcttttgg
ccaaacgtagagtttttaggagtcgttgcagaaacttcctacggatgcagttatttcttg
aacctgcataaagccacaagccatcctgtccttgtttacatgccggctggtcagctcgct
agagacatcgagaaaaagtccgatgaagcagctgcaaattttgccttttcgcaactacag
aaaattcttccagatgcctcttcaccgataaattatttggtatcaaggtggggatcagac
atcaattcattgggatcatatagctatgacattgtgaacaaacctcacgacctctatgag
agactgagagtgccattggataatctattctttgcgggggaagccactagctcaagctac
ccgggatcagtgcacggtgcttattcaaccggagtgctggcagctgaagactgcaggatg
cgtgtgcttgagcgctatggagagctcgaacatgagatggaagaggaagctcctgcttct
gtccctcttctgatctcccgtatgtaa

DBGET integrated database retrieval system