KEGG   Arabidopsis thaliana (thale cress): AT1G65960
Entry
AT1G65960         CDS       T00041                                 
Symbol
GAD2
Name
(RefSeq) glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00250  Alanine, aspartate and glutamate metabolism
ath00410  beta-Alanine metabolism
ath00430  Taurine and hypotaurine metabolism
ath00650  Butanoate metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Module
ath_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AT1G65960 (GAD2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AT1G65960 (GAD2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT1G65960 (GAD2)
   00430 Taurine and hypotaurine metabolism
    AT1G65960 (GAD2)
Enzymes [BR:ath01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AT1G65960 (GAD2)
SSDB
Motif
Pfam: Pyridoxal_deC Aminotran_5
Other DBs
NCBI-GeneID: 842908
NCBI-ProteinID: NP_001117556
TAIR: AT1G65960
UniProt: Q42472 A0A178WE81
Position
1:24551807..24557730
AA seq 494 aa
MVLTKTATNDESVCTMFGSRYVRTTLPKYEIGENSIPKDAAYQIIKDELMLDGNPRLNLA
SFVTTWMEPECDKLIMDSINKNYVDMDEYPVTTELQNRCVNIIARLFNAPLEESETAVGV
GTVGSSEAIMLAGLAFKRKWQNKRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKEV
NLSEGYYVMDPDKAAEMVDENTICVAAILGSTLNGEFEDVKRLNDLLVKKNEETGWNTPI
HVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRAAEDLPEELI
FHINYLGADQPTFTLNFSKGSSQIIAQYYQLIRLGFEGYKNVMENCIENMVVLKEGIEKT
ERFNIVSKDQGVPVVAFSLKDHSFHNEFEISEMLRRFGWIVPAYTMPADAQHITVLRVVI
REDFSRTLAERLVADISKVLHELDTLPSKISKKMGIEGIAENVKEKKMEKEILMEVIVGW
RKFVKERKKMNGVC
NT seq 1485 nt   +upstreamnt  +downstreamnt
atggttttgacaaaaaccgcaacgaatgatgaatctgtctgcaccatgttcggatctcgc
tatgttcgcactacacttcccaagtatgagattggtgagaattcgataccgaaagacgct
gcgtatcagatcataaaagatgagctgatgcttgatggtaacccaaggcttaacctagct
tcttttgtgactacatggatggaaccagagtgtgacaaactcatcatggactctatcaat
aagaactacgttgatatggatgagtaccctgtcacaactgagctccagaaccgatgtgta
aacattatagctcgactgttcaatgcgccactcgaggaatctgagacggcggtgggagta
gggacagttggttcttcagaagccatcatgttagccggattggccttcaaaagaaaatgg
cagaacaaacgcaaggctgagggtaaaccctatgacaaacccaacattgtcaccggagcc
aatgttcaagtttgctgggagaaattcgctcggtacttcgaggtggagctaaaggaagta
aacctaagtgaaggttactacgtgatggatccagacaaagcagcagaaatggtagacgag
aacacaatctgtgtcgcagccatattgggatccacactcaacggtgagttcgaagacgtg
aaacgtctcaatgacttgctagtcaagaaaaacgaggagactggttggaacacaccgatc
cacgtggatgcagcaagtggagggttcatagctccgtttatctatcctgaattagaatgg
gactttaggcttcctttggttaagagcatcaacgtgagtggtcacaagtatggactagtc
tatgctggtattggttgggtcgtgtggagggcagcagaggatttacctgaagagcttatc
tttcatattaattatcttggtgctgatcaacccactttcactctcaatttctccaaggga
tcgagccaaattattgctcaatactaccagctcattcgtcttggattcgaggggtacaaa
aatgtgatggagaattgcatagagaacatggtggttctcaaagaaggtatagagaaaaca
gagcgtttcaacatagtctcaaaggaccaaggagtgccagtcgtcgccttctctctcaag
gaccatagtttccacaacgagttcgagatctctgagatgctacgtcgttttggctggatc
gtcccagcttacactatgcctgccgatgcacagcacatcacggttctgcgtgttgtcatc
agggaagatttctcaagaacactcgcggagagacttgttgctgatatttcgaaggtgctt
catgagctagataccttgccttccaagatatctaagaagatgggaatagaagggatcgcg
gaaaatgtaaaggagaagaagatggagaaggagattctgatggaagttattgttggatgg
aggaagtttgtgaaggagaggaagaagatgaatggtgtgtgctaa

KEGG   Arabidopsis thaliana (thale cress): AT2G02000
Entry
AT2G02000         CDS       T00041                                 
Symbol
GAD3
Name
(RefSeq) glutamate decarboxylase 3
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00250  Alanine, aspartate and glutamate metabolism
ath00410  beta-Alanine metabolism
ath00430  Taurine and hypotaurine metabolism
ath00650  Butanoate metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Module
ath_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AT2G02000 (GAD3)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AT2G02000 (GAD3)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT2G02000 (GAD3)
   00430 Taurine and hypotaurine metabolism
    AT2G02000 (GAD3)
Enzymes [BR:ath01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AT2G02000 (GAD3)
SSDB
Motif
Pfam: Pyridoxal_deC
Other DBs
NCBI-GeneID: 814731
NCBI-ProteinID: NP_178309
TAIR: AT2G02000
UniProt: Q9ZPS4
Position
2:complement(469370..472070)
AA seq 500 aa
MVLSKTASKSDDSIHSTFASRYVRNSISRFEIPKNSIPKEAAYQIINDELKFDGNPRLNL
ASFVTTWMEPECDKLMMESINKNNVEMDQYPVTTDLQNRCVNMIARLFNAPLGDGEAAIG
VGTVGSSEAVMLAGLAFKRQWQNKRKALGLPYDRPNIVTGANIQVCLEKFARYFEVELKE
VKLREGYYVMDPDKAVEMVDENTICVVAILGSTLTGEFEDVKLLNDLLVEKNKKTGWDTP
IHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRTKTDLPDEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMDNCRENMMVLRQGLEK
TGRFNIVSKENGVPLVAFSLKDSSRHNEFEVAEMLRRFGWIVPAYTMPADAQHVTVLRVV
IREDFSRTLAERLVADFEKVLHELDTLPARVHAKMASGKVNGVKKTPEETQREVTAYWKK
FVDTKTDKNGVPLVASITNQ
NT seq 1503 nt   +upstreamnt  +downstreamnt
atggttttatctaagacagcttccaaatccgatgattcaatccattcaacttttgcttcc
cgttatgtccgcaactctatctcacgattcgaaatacctaagaactcgatccctaaggaa
gcagcataccaaatcatcaacgacgagctcaagtttgacggtaacccgaggctaaacctg
gcctcctttgtgaccacttggatggagccagaatgtgacaagctcatgatggaatccatc
aacaagaacaacgttgagatggaccaataccctgttaccaccgaccttcagaatcgatgc
gttaacatgattgcgcgtctcttcaacgcgcctttaggtgacggtgaagccgccattggt
gttggcacggtggggtcatcggaggcagtgatgttggccggactggcctttaagagacag
tggcagaacaagcgtaaggccctagggctgccttatgatagacctaatattgtaaccgga
gccaatattcaggtttgcttggagaaatttgcaaggtattttgaagtggagcttaaggaa
gtgaagctgagagaaggatattacgtgatggaccctgacaaagcggttgaaatggtagac
gaaaacactatatgcgtcgtggccatcctcggttcgacactaaccggagaattcgaagac
gttaagctcctcaacgaccttttagtcgagaaaaacaagaaaaccggatgggatacgccg
attcacgtggacgcagcgagtggtgggtttattgctcccttcttgtatccggacttggag
tgggatttccggttaccgttggttaagagcataaatgtgagtggtcacaaatacggtttg
gtttacgccggtatcggttgggtcgtatggagaaccaaaaccgatttgcctgatgaactt
atcttccatatcaattatcttggagctgatcaacccacatttaccctcaacttctctaaa
gggtcaagtcaagtgattgctcagtactaccagttgattcgtcttggattcgagggatat
cgcaacgtgatggataattgccgcgagaacatgatggtactaagacaaggattagagaaa
acgggacgttttaacatcgtctccaaagaaaacggtgttccgttagtggcgttttctctc
aaagatagtagccgccacaacgagttcgaggtggccgaaatgcttcgtcgcttcggctgg
atcgttccggcctacacgatgcctgcggatgcgcaacatgtcacggtccttcgagttgtt
atccgagaagatttctctcgaaccttagctgagagattggtagccgatttcgagaaggtt
ctacacgagctcgatacgcttcccgcgagggttcacgccaagatggctagtggaaaagtt
aacggtgttaagaagacgccagaggagacgcaaagagaagtcacggcctactggaagaag
tttgtggacactaagactgacaagaacggcgttccgttagtagcaagtattaccaatcaa
tga

KEGG   Arabidopsis thaliana (thale cress): AT2G02010
Entry
AT2G02010         CDS       T00041                                 
Symbol
GAD4
Name
(RefSeq) glutamate decarboxylase 4
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00250  Alanine, aspartate and glutamate metabolism
ath00410  beta-Alanine metabolism
ath00430  Taurine and hypotaurine metabolism
ath00650  Butanoate metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Module
ath_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AT2G02010 (GAD4)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AT2G02010 (GAD4)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT2G02010 (GAD4)
   00430 Taurine and hypotaurine metabolism
    AT2G02010 (GAD4)
Enzymes [BR:ath01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AT2G02010 (GAD4)
SSDB
Motif
Pfam: Pyridoxal_deC
Other DBs
NCBI-GeneID: 814732
NCBI-ProteinID: NP_178310
TAIR: AT2G02010
UniProt: Q9ZPS3
Position
2:complement(474108..476997)
AA seq 493 aa
MVLSKTVSESDVSIHSTFASRYVRNSLPRFEMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLMMESINKNYVDMDEYPVTTELQNRCVNMIARLFNAPLGDGEAAVG
VGTVGSSEAIMLAGLAFKRQWQNKRKAQGLPYDKPNIVTGANVQVCWEKFARYFEVELKE
VNLREDYYVMDPVKAVEMVDENTICVAAILGSTLTGEFEDVKLLNDLLVEKNKQTGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRTKTDLPDEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMDNCRENMMVLRQGLEK
TGRFKIVSKENGVPLVAFSLKDSSRHNEFEVAHTLRRFGWIVPAYTMPADAQHVTVLRVV
IREDFSRTLAERLVADFEKVLHELDTLPARVHAKMANGKVNGVKKTPEETQREVTAYWKK
LLETKKTNKNTIC
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggttttgtctaagacagtttccgaatctgatgtctcaatccattcaacttttgcttct
cgttacgtccgcaactctcttccacgattcgaaatgcctgagaactcaatcccaaaagaa
gcagcttaccaaatcatcaacgacgagctaatgctcgatggtaacccaaggctgaaccta
gcttccttcgtgaccacatggatggagccagaatgtgacaagctcatgatggagtccatc
aacaagaactacgtcgacatggacgagtaccctgtcaccactgagcttcagaaccgatgt
gttaacatgatagcacgtctcttcaacgcgccgcttggtgacggtgaagctgccgttggt
gttggcaccgtcggatcgtcggaggcgattatgttggccggtttggcttttaagagacaa
tggcagaataagcgtaaggcccaagggcttccttatgataagcccaatatcgtaaccggt
gctaatgtccaggtttgctgggagaaattcgcaaggtatttcgaagtggagcttaaggaa
gtgaacctaagagaagactattacgtgatggaccctgtaaaggcggtcgaaatggtagac
gaaaacacaatttgtgtcgctgccatcctcggttcaacgttaaccggtgaattcgaagac
gttaagctcctcaacgacctccttgtcgagaaaaacaagcaaaccggatgggacacgcca
atacacgtggacgcagcgagtggtgggtttattgctccgttcttgtatccggagctggag
tgggatttccggctaccgttggttaagagtattaatgtgagtggtcacaaatacggtttg
gtttacgccggtattggttgggttgtatggagaaccaaaaccgatttgcctgatgaactt
atcttccatatcaattatcttggcgctgatcaaccaacctttacactcaacttctccaaa
ggttcaagtcaagtgattgctcagtactaccagctgattcgtcttggattcgagggttat
cgcaatgtgatggataattgtcgggaaaacatgatggtactaagacaaggattagagaaa
acgggacgttttaaaatcgtctccaaagaaaacggtgttccgttagtggcgttttctctc
aaagatagtagccgccacaacgagttcgaggtggcccatacactccgtcgcttcggctgg
atcgttccggcctacacgatgcctgcggatgcgcagcatgtcactgtccttcgagttgtt
atccgagaagatttctctcgaaccttagccgagagattggtagctgatttcgagaaggtt
ctacacgagctcgatacgcttccggcgagggttcacgccaagatggctaatggaaaagtt
aacggtgttaagaagacgccagaggagacgcagagagaagtcacggcctactggaagaag
ttgttggagactaagaagaccaacaagaacacaatttgctaa

KEGG   Arabidopsis thaliana (thale cress): AT3G17760
Entry
AT3G17760         CDS       T00041                                 
Symbol
GAD5
Name
(RefSeq) glutamate decarboxylase 5
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00250  Alanine, aspartate and glutamate metabolism
ath00410  beta-Alanine metabolism
ath00430  Taurine and hypotaurine metabolism
ath00650  Butanoate metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Module
ath_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AT3G17760 (GAD5)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AT3G17760 (GAD5)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT3G17760 (GAD5)
   00430 Taurine and hypotaurine metabolism
    AT3G17760 (GAD5)
Enzymes [BR:ath01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AT3G17760 (GAD5)
SSDB
Motif
Pfam: Pyridoxal_deC Aminotran_5 Pvc16_N
Other DBs
NCBI-GeneID: 821044
NCBI-ProteinID: NP_188403
TAIR: AT3G17760
UniProt: Q9LSH2 A0A178VFR2
Position
3:complement(6078727..6081355)
AA seq 494 aa
MVLATNSDSDEHLHSTFASRYVRAVVPRFKMPDHCMPKDAAYQVINDELMLDGNPRLNLA
SFVTTWMEPECDKLIMDSVNKNYVDMDEYPVTTELQNRCVNMIANLFHAPVGEDEAAIGC
GTVGSSEAIMLAGLAFKRKWQHRRKAQGLPIDKPNIVTGANVQVCWEKFARYFEVELKEV
KLSEDYYVMDPAKAVEMVDENTICVAAILGSTLTGEFEDVKQLNDLLAEKNAETGWETPI
HVDAASGGFIAPFLYPDLEWDFRLPWVKSINVSGHKYGLVYAGVGWVVWRTKDDLPEELV
FHINYLGADQPTFTLNFSKGSSQIIAQYYQFIRLGFEGYKNIMENCMDNARRLREGIEMT
GKFNIVSKDIGVPLVAFSLKDSSKHTVFEIAESLRKFGWIIPAYTMPADAQHIAVLRVVI
REDFSRGLADRLITHIIQVLKEIEGLPSRIAHLAAAAAVSGDDEEVKVKTAKMSLEDITK
YWKRLVEHKRNIVC
NT seq 1485 nt   +upstreamnt  +downstreamnt
atggtactcgcaaccaactctgactccgacgagcatttgcattccacttttgcttctaga
tatgtccgtgctgttgttcccaggttcaagatgcctgaccattgcatgcccaaagatgct
gcttatcaagtgatcaatgatgagttgatgcttgatggtaatcccaggcttaacctagcc
tcctttgtcaccacttggatggaacctgagtgtgacaaactcatcatggattctgtcaat
aagaactatgttgatatggatgaatatcctgtcaccactgagctccagaaccggtgtgta
aatatgatagcaaacttgttccatgctcccgttggagaagacgaggctgctattgggtgt
ggaactgttggttcatctgaggctataatgcttgctggtttggctttcaaaaggaaatgg
caacataggagaaaagctcagggtctacctattgataagcctaacattgtcactggagcc
aatgttcaggtgtgctgggagaagtttgcaaggtactttgaggtagagctcaaagaggtg
aaactaagtgaagactactatgttatggatccagctaaagctgtagagatggtggatgag
aataccatctgtgttgcagcaattctaggatccacacttactggagagtttgaggacgtt
aagcaattgaacgatctcttagctgagaaaaacgcagagacaggatgggaaactcctatt
catgttgatgcagccagtggaggattcattgctcctttcctctaccctgatcttgaatgg
gactttaggcttccatgggtgaagagtattaacgtcagtggtcacaagtatggacttgtg
tatgcaggagttggttgggttgtctggagaacaaaagatgatttgccagaggaacttgtc
ttccacatcaactacttgggagctgatcaacccactttcactctcaacttctcaaaaggg
tcgagccaaatcattgctcagtactatcagtttatccgactaggctttgagggatacaag
aacataatggaaaactgcatggataacgcaaggaggctaagagaaggaatagagatgaca
gggaagttcaacattgtgtccaaagatattggcgtgccactagtggcattctctctcaaa
gacagtagcaagcacacggtgtttgagatcgcagagtctttgagaaaattcgggtggatc
ataccggcttacactatgcctgcagatgcacagcacattgctgtgctcagagttgtgata
agagaagactttagccgaggccttgcagatagactcatcacacatatcattcaggtgctg
aaagagattgaagggcttcctagcaggattgcacatcttgctgcggctgcagcggttagt
ggtgatgatgaagaagttaaagtgaagactgccaagatgtccttggaggatatcactaag
tattggaaacgccttgtggaacacaagagaaatattgtctgctaa

KEGG   Arabidopsis thaliana (thale cress): AT5G17330
Entry
AT5G17330         CDS       T00041                                 
Symbol
GAD
Name
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00250  Alanine, aspartate and glutamate metabolism
ath00410  beta-Alanine metabolism
ath00430  Taurine and hypotaurine metabolism
ath00650  Butanoate metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Module
ath_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AT5G17330 (GAD)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AT5G17330 (GAD)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT5G17330 (GAD)
   00430 Taurine and hypotaurine metabolism
    AT5G17330 (GAD)
Enzymes [BR:ath01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AT5G17330 (GAD)
SSDB
Motif
Pfam: Pyridoxal_deC Aminotran_5
Other DBs
NCBI-GeneID: 831599
NCBI-ProteinID: NP_197235
TAIR: AT5G17330
UniProt: Q42521 A0A5S9Y4Y1
Structure
Position
5:5710910..5715075
AA seq 502 aa
MVLSHAVSESDVSVHSTFASRYVRTSLPRFKMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMSSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLEEAETAVG
VGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPVDKPNIVTGANVQVCWEKFARYFEVELKE
VKLSEGYYVMDPQQAVDMVDENTICVAAILGSTLNGEFEDVKLLNDLLVEKNKETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGHEGYRNVMENCRENMIVLREGLEK
TERFNIVSKDEGVPLVAFSLKDSSCHTEFEISDMLRRYGWIVPAYTMPPNAQHITVLRVV
IREDFSRTLAERLVIDIEKVMRELDELPSRVIHKISLGQEKSESNSDNLMVTVKKSDIDK
QRDIITGWKKFVADRKKTSGIC
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggtgctctcccacgccgtatcggagtcggacgtctccgtccactccacattcgcatca
cgttacgtccgtacttcacttcctaggttcaagatgccggaaaactcgattcctaaggaa
gcggcgtatcagatcatcaacgacgagctgatgcttgacgggaatccacggttgaactta
gcctcctttgtgacgacatggatggagcctgagtgtgataaactcatcatgtcctccatc
aacaagaactatgttgacatggacgagtaccccgtcaccaccgaacttcagaaccgatgt
gtgaacatgattgcacatctattcaatgcaccgttagaagaggcggagaccgccgtcgga
gtaggaaccgttggatcatcggaggccataatgttggccggtttggccttcaagcgtaaa
tggcagaacaagcgcaaagctgaaggcaaacccgtcgataaacccaacattgtcaccgga
gccaatgttcaagtgtgttgggagaaattcgctaggtactttgaggttgaacttaaggaa
gtgaaattgagtgaaggatactatgtgatggaccctcaacaagctgttgatatggttgat
gagaacaccatttgtgttgcggccattcttggttccactcttaatggagaattcgaagat
gttaaactcttgaacgatctcttggtcgaaaagaacaaagaaaccggatgggatacacca
atccacgtggatgcggcaagtggaggattcattgcaccgtttttgtatccggaattggaa
tgggactttagacttcccttggtgaagagtatcaatgtgagtggtcacaagtatggactt
gtgtacgcagggattggttgggtgatctggagaaacaaagaggatttgcctgaggaactc
atcttccatatcaattatcttggtgctgaccaacccacctttactctcaatttctccaaa
ggttcaagtcaagtcattgctcaatactaccaacttatccgattgggccacgagggttac
agaaatgtgatggagaattgcagagagaatatgatcgtcctaagggaaggacttgagaag
acagaaaggttcaacatcgtctcaaaggacgagggagtgccacttgtcgctttctccttg
aaagatagcagctgtcacactgagttcgaaatctccgacatgcttcgcaggtatggatgg
atagtgccggcctacacaatgcctccaaatgcacaacacatcactgttcttcgtgtggtt
atcagagaagatttctcgagaacactcgctgagagacttgtgatcgatatagagaaagtg
atgcgtgagctcgatgagcttccttcgagagtgattcacaaaatatcacttggacaagag
aagagtgaatctaacagcgataacttgatggtcacggtgaagaagagcgatatcgacaag
cagagagatatcatcactggctggaagaagtttgtcgccgacaggaagaagacgagtggt
atctgctaa

DBGET integrated database retrieval system