KEGG   Arabidopsis thaliana (thale cress): AT2G04630
Entry
AT2G04630         CDS       T00041                                 
Symbol
NRPB6B
Name
(RefSeq) RNA polymerase Rpb6
  KO
K03014  DNA-directed RNA polymerases I, II, and III subunit RPABC2
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT2G04630 (NRPB6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT2G04630 (NRPB6B)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT2G04630 (NRPB6B)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     AT2G04630 (NRPB6B)
  RNA polymerase III system
   RNA polymerase III
     AT2G04630 (NRPB6B)
  RNA polymerase I system
   RNA polymerase I
     AT2G04630 (NRPB6B)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      AT2G04630 (NRPB6B)
SSDB
Motif
Pfam: RNA_pol_Rpb6 DUF4549
Other DBs
NCBI-GeneID: 815006
NCBI-ProteinID: NP_178540
TAIR: AT2G04630
UniProt: Q9SJ96 A0A5S9WX44
Position
2:complement(1618791..1620379)
AA seq 144 aa
MADDDYNEVDDLGYEDEPAEPEIEEGVEEDADIKENDDVNVDPLETEDKVETEPVQRPRK
TSKFMTKYERARILGTRALQISMNAPVMVELEGETDPLEIAMKELRQRKIPFTIRRYLPD
MSYEEWGVDELIVEDSWKRQVGGD
NT seq 435 nt   +upstreamnt  +downstreamnt
atggctgacgacgattacaatgaagtcgatgacttgggatatgaagatgagccagcagag
cctgagatcgaagaaggagtagaggaagatgctgatatcaaggagaacgatgatgttaat
gttgaccctttggaaacagaagataaggttgaaacagaacctgtgcaacgcccacgtaaa
acctctaagtttatgactaagtatgaacgtgcacgtatcctcggcactcgtgctttgcag
attagcatgaatgctcctgttatggttgagttggagggtgagactgatccacttgagatt
gcgatgaaagagcttaggcaaaggaagattccatttaccattagacgttatctacctgat
atgagttacgaggaatggggagttgatgaactgatcgtcgaagactcgtggaaacgtcaa
gtcggtggtgattga

KEGG   Arabidopsis thaliana (thale cress): AT5G51940
Entry
AT5G51940         CDS       T00041                                 
Symbol
NRPB6A
Name
(RefSeq) RNA polymerase Rpb6
  KO
K03014  DNA-directed RNA polymerases I, II, and III subunit RPABC2
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT5G51940 (NRPB6A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT5G51940 (NRPB6A)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT5G51940 (NRPB6A)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     AT5G51940 (NRPB6A)
  RNA polymerase III system
   RNA polymerase III
     AT5G51940 (NRPB6A)
  RNA polymerase I system
   RNA polymerase I
     AT5G51940 (NRPB6A)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      AT5G51940 (NRPB6A)
SSDB
Motif
Pfam: RNA_pol_Rpb6 DUF4549
Other DBs
NCBI-GeneID: 835269
NCBI-ProteinID: NP_200007
TAIR: AT5G51940
UniProt: Q9FJ98 A0A178UA32
Structure
Position
5:21104551..21105947
AA seq 144 aa
MADEDYNDVDDLGYEDEPAEPEIEEGVEEDVEMKENDDVNGEPIEAEDKVETEPVQRPRK
TSKFMTKYERARILGTRALQISMNAPVMVELEGETDPLEIAMKELRQRKIPFTIRRYLPD
GSFEEWGVDELIVEDSWKRQVGGD
NT seq 435 nt   +upstreamnt  +downstreamnt
atggctgacgaagattacaacgacgtcgatgacttgggatatgaggatgagccagcagag
cctgagattgaagaaggagtagaggaagatgttgaaatgaaggagaatgatgatgtcaat
ggtgagcctattgaagctgaagataaagtcgaaacagaacctgtgcaacgtccacgcaaa
acgtcaaagtttatgaccaagtatgagcgtgctcgtatcctcggcactcgcgctttgcag
attagcatgaatgctcctgtcatggttgagctagagggtgagactgatccacttgagatt
gcgatgaaggagcttaggcagcggaagataccattcactattagacgctatctacctgat
gggagtttcgaggaatggggagttgatgaactgatcgtggaagactcatggaaacgtcaa
gttggtggtgattga

DBGET integrated database retrieval system