KEGG   Arabidopsis thaliana (thale cress): AT2G06510
Entry
AT2G06510         CDS       T00041                                 
Symbol
RPA1A
Name
(RefSeq) replication protein A 1A
  KO
K07466  replication factor A1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03030  DNA replication
ath03420  Nucleotide excision repair
ath03430  Mismatch repair
ath03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AT2G06510 (RPA1A)
   03420 Nucleotide excision repair
    AT2G06510 (RPA1A)
   03430 Mismatch repair
    AT2G06510 (RPA1A)
   03440 Homologous recombination
    AT2G06510 (RPA1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT2G06510 (RPA1A)
   03032 DNA replication proteins [BR:ath03032]
    AT2G06510 (RPA1A)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT2G06510 (RPA1A)
Transcription factors [BR:ath03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    AT2G06510 (RPA1A)
DNA replication proteins [BR:ath03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    AT2G06510 (RPA1A)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     AT2G06510 (RPA1A)
   MMR (mismatch excision repair)
     AT2G06510 (RPA1A)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     AT2G06510 (RPA1A)
SSDB
Motif
Pfam: Rep_fac-A_C Rep-A_N REPA_OB_2 tRNA_anti-codon
Other DBs
NCBI-GeneID: 815209
NCBI-ProteinID: NP_178690
TAIR: AT2G06510
UniProt: Q9SKI4 A0A5S9WXI6
Position
2:2584984..2587686
AA seq 640 aa
MPVSLTPNAITAIHDGDVNLKPLLQVLEIKMIGRSQERSQERYRFLISDGVSAQHAMVAV
QLNDRVKSGQFEKGSIVQLIDYICSDVKGRKLIVVLNMETIVQQSETIGNPTIFGETDTE
AQKTFSGTGNIPPPNRVVFNEPMVQHSVNRAPPRGVNIQNQANNTPSFRPSVQPSYQPPA
SYRNHGPIMKNEAPARVIPIAALNPYQGRWAIKARVTAKGDIRRYNNAKGDGKVFSFDLL
DYDGGEIRVTCFNALVDRFYDVTEVGKVYLISKGSLKPAQKNFNHLKNEWEIFLESTSTV
ELCPDEDGSIPKQQFSFRPISDIENAENNTILDVIGVVTSVNPSVPILRKNGMETHRRIL
NLKDESGKAVEVTLWGEFCNRDGRQLEEMVDSAFHPVLAIKAGKVSDFSGKSVGTISSTQ
LFINPDFPEAHKLRTWFDYGGKDTASFSISRDTMPGGVSRNEIRKNVSQIKEEGLGRSDK
PDWITVKATISFIKTDSFCYTACPLMIGDKQCNKKVTRSGTNRWLCDRCNQESDECDYRY
LLQVQIQDHTGLTWITAFQETGEEIMGCPAKKLYAMKYELEKEEEFAEIVRDRLFHQYML
KLKIKEESYGDEQRVKMTVVKVDKVNYTSESKYMLDLLVR
NT seq 1923 nt   +upstreamnt  +downstreamnt
atgccggtgagtttgactccgaacgcaatcacggcgatacatgacggcgacgtgaatttg
aagccgttgttacaggttttagaaatcaaaatgataggaagaagtcaagagagaagccag
gagaggtatcgtttcctcatttcagatggtgtttctgctcaacatgctatggtcgcggtt
cagcttaatgatcgagtcaagtcaggacaatttgagaaaggatctatcgttcagctgatt
gattacatttgtagcgacgttaaaggccgcaagcttattgtggtgctgaacatggagacg
atagtacaacagtctgaaaccattgggaaccctacaatatttggagaaacagatacagaa
gcccagaagacattttcaggtacgggcaatataccgcctccgaacagggttgtttttaat
gaaccaatggttcagcattctgttaatagagcacctcccaggggtgtaaacattcaaaat
caagccaacaatactccaagcttcaggccatctgttcaaccttcatatcaaccgcctgca
agttacagaaatcatggacccatcatgaagaacgaggctccagctcgagtcatccctatt
gctgctctcaatccataccaaggtcgatgggctattaaggctagagtaactgcgaaagga
gatatcagacgatataacaatgcaaaaggagatggaaaggttttctcgtttgatctgctt
gactatgatggaggggagattcgggttacgtgctttaatgctcttgttgaccgtttctat
gatgttactgaggttggtaaggtatatttgatttcaaagggaagtttgaagcctgcacag
aaaaatttcaaccacttaaagaatgaatgggaaattttcttggagtcaacatcgactgtg
gagctttgccctgatgaagatggctccataccaaagcagcaattctccttccgcccaata
agtgacattgagaacgctgagaacaataccatactcgatgtcattggtgtggtgacttct
gtgaacccctcggtgccaatcttgagaaagaacgggatggaaacccataggaggatcctg
aatctaaaggatgaatcaggaaaggctgtagaggtaacactttggggagaattctgtaac
cgagatggtcggcaactggaagagatggttgattcagcttttcacccggttttagcaata
aaagctggaaaagtaagcgacttcagtgggaaatcagtagggacaatatcttcaacacag
ctcttcataaatccagatttccctgaagctcataaactacggacctggttcgattacggg
ggaaaagacactgcttccttctccatctccagggacactatgcctggaggagtttccagg
aacgagataaggaaaaatgtttctcagatcaaagaggaaggtcttggaagatcagataag
cctgactggatcactgtgaaagcaaccatatcattcatcaaaacagatagcttctgttat
acagcttgtcctttgatgatcggggataaacaatgcaacaagaaggttacacggtctgga
acaaacaggtggctctgtgaccggtgcaaccaagagtctgatgaatgcgactatagatac
cttcttcaggtacagattcaagaccacactgggttgacttggataaccgcgtttcaagaa
acaggagaagaaataatgggatgtccggctaagaagctttacgcaatgaaatacgaattg
gagaaggaggaagagttcgcagagattgttagagacagactgtttcatcagtacatgttg
aagctgaagatcaaagaggaatcgtatggggatgaacaaagagtgaagatgactgttgtg
aaggttgataaggtgaattatacatccgagagtaaatacatgcttgatttgctcgtaagg
taa

KEGG   Arabidopsis thaliana (thale cress): AT2G24490
Entry
AT2G24490         CDS       T00041                                 
Symbol
RPA2
Name
(RefSeq) replicon protein A2
  KO
K10739  replication factor A2
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03030  DNA replication
ath03420  Nucleotide excision repair
ath03430  Mismatch repair
ath03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AT2G24490 (RPA2)
   03420 Nucleotide excision repair
    AT2G24490 (RPA2)
   03430 Mismatch repair
    AT2G24490 (RPA2)
   03440 Homologous recombination
    AT2G24490 (RPA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ath03032]
    AT2G24490 (RPA2)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT2G24490 (RPA2)
DNA replication proteins [BR:ath03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    AT2G24490 (RPA2)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     AT2G24490 (RPA2)
   MMR (mismatch excision repair)
     AT2G24490 (RPA2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     AT2G24490 (RPA2)
SSDB
Motif
Pfam: RPA_C tRNA_anti-codon TrmB Rrf2 RMI2 PCI RNA_pol_I_A49 HTH_25 B-block_TFIIIC HTH_IclR MarR
Other DBs
NCBI-GeneID: 816985
NCBI-ProteinID: NP_565571
TAIR: AT2G24490
UniProt: Q9ZQ19 A0A178VTA7
Position
2:complement(10397377..10400802)
AA seq 279 aa
MFSSSQFEPNSGFSGGGFMSSQPSQAYESSSSTAKNRDFQGLVPVTVKQITECFQSSGEK
SGLVINGISLTNVSLVGLVCDKDESKVTEVRFTLDDGTGRIDCKRWVSETFDAREMESVR
DGTYVRLSGHLKTFQGKTQLLVFSVRPIMDFNEVTFHYIECIHFYSQNSESQRQQVGDVT
QSVNTTFQGGSNTNQATLLNPVVSSQNNDGNGRKNLDDMILDYLKQPACTARQQGIHIDE
IAQQLKIPKNKLEGVVQSLEGDGLIYSTIDEYHFKHVEL
NT seq 840 nt   +upstreamnt  +downstreamnt
atgttctccagcagccaattcgagcctaattccggcttctccggcggcggattcatgtct
tctcaaccttctcaagcctacgaatcctcctcctccaccgctaagaatcgtgattttcaa
ggtcttgttccagtgacggtgaagcaaatcaccgaatgtttccaatccagtggtgaaaaa
tctggtctcgtcatcaatggaatctcactaacaaacgtttcacttgttggattagtgtgt
gacaaagatgaatctaaagtcacagaagttagattcactcttgatgatggaacaggacga
attgactgtaaaagatgggtgagtgaaactttcgacgctagagaaatggagtctgtgcga
gatggaacttatgtgcgcctcagtggtcatttgaagacttttcagggcaaaactcagctt
cttgttttctctgtgaggcctattatggacttcaatgaggttacttttcactacattgag
tgtatacacttctactcccagaactctgaatcacagagacaacaagtcggtgatgtcact
cagtcagttaacaccacatttcaaggtggatcaaacacaaaccaggcaacactattgaac
cctgtggtttcttctcaaaacaatgatggcaatgggcgcaagaacttggatgatatgatt
ctagactatctaaagcaacctgcttgcactgcaagacaacaggggatacatatcgatgaa
attgctcagcagttgaagatcccaaaaaacaagctagagggcgttgttcaatcactggaa
ggagatggtctaatatactcgacaatcgatgagtatcacttcaagcacgtggagctttga

KEGG   Arabidopsis thaliana (thale cress): AT3G02920
Entry
AT3G02920         CDS       T00041                                 
Symbol
RPA32B
Name
(RefSeq) Replication protein A, subunit RPA32
  KO
K10739  replication factor A2
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03030  DNA replication
ath03420  Nucleotide excision repair
ath03430  Mismatch repair
ath03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AT3G02920 (RPA32B)
   03420 Nucleotide excision repair
    AT3G02920 (RPA32B)
   03430 Mismatch repair
    AT3G02920 (RPA32B)
   03440 Homologous recombination
    AT3G02920 (RPA32B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ath03032]
    AT3G02920 (RPA32B)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT3G02920 (RPA32B)
DNA replication proteins [BR:ath03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    AT3G02920 (RPA32B)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     AT3G02920 (RPA32B)
   MMR (mismatch excision repair)
     AT3G02920 (RPA32B)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     AT3G02920 (RPA32B)
SSDB
Motif
Pfam: RPA_C tRNA_anti-codon RMI2
Other DBs
NCBI-GeneID: 821187
NCBI-ProteinID: NP_566188
TAIR: AT3G02920
UniProt: Q8LFJ8
Position
3:complement(651572..654487)
AA seq 278 aa
MYGGDFDGNAAFAGGGFMPSQATTQAHESSSSLKNRDVRTLLPLTLKQLSSASTTGESNF
SIDGVDIKTVVIVGRISRMENRITQVDFVVDDGTGWVDCVRWCHARQETEEMEAVKLGMY
VRLHGHLKIFQGKRSVNVFSVRPVTDFNEIVHHFTECMYVHMYNTKLRGGSITQDTATPR
PQMPYSTMPTPAKPYQTGPSNQFPNQFNDSMHGVKQTVLNYLNQPMHIVSEAGVHCDIIA
RELRIPLLQVKEALEQLSNDGCIYSTLDETCFKSTANA
NT seq 837 nt   +upstreamnt  +downstreamnt
atgtacggaggcgattttgacggcaacgctgctttcgccggcggcggcttcatgccttct
caggcgactacgcaagcccatgaatcctcatcttccctcaagaaccgcgatgtacgtacc
ttgcttcccctgacactgaagcagttgagcagcgcatcaaccactggcgaatcaaatttc
tctattgatggcgttgatattaaaactgttgtaatcgttggacggatttctagaatggag
aacagaatcactcaggtcgattttgttgttgatgacggtacaggctgggttgattgtgtc
agatggtgtcacgctcggcaagaaactgaagaaatggaagcagtcaagctgggaatgtat
gttcgcttacatggacacctgaaaatttttcaagggaaacgatctgtgaatgttttttca
gtcaggcctgtcactgacttcaatgagattgtacaccactttaccgagtgtatgtatgtc
cacatgtacaacaccaagttacggggtggttctattactcaagatactgctactcctagg
ccccaaatgccatattcaacaatgccaacccctgcaaagccctaccaaaccggtccatct
aatcagttcccgaaccaattcaatgattcaatgcatggtgtaaagcagacggtcttgaat
tacctgaatcaacctatgcacattgtatctgaagctggagttcactgtgatataattgcc
cgtgaactcaggattccgctgcttcaagtcaaggaagcgttagaacagctctcaaacgat
ggttgcatatactcgactttggacgagacatgcttcaaatcgactgctaacgcttga

KEGG   Arabidopsis thaliana (thale cress): AT3G52630
Entry
AT3G52630         CDS       T00041                                 
Name
(RefSeq) Nucleic acid-binding, OB-fold-like protein
  KO
K10740  replication factor A3
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03030  DNA replication
ath03420  Nucleotide excision repair
ath03430  Mismatch repair
ath03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AT3G52630
   03420 Nucleotide excision repair
    AT3G52630
   03430 Mismatch repair
    AT3G52630
   03440 Homologous recombination
    AT3G52630
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ath03032]
    AT3G52630
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT3G52630
DNA replication proteins [BR:ath03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    AT3G52630
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     AT3G52630
   MMR (mismatch excision repair)
     AT3G52630
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     AT3G52630
SSDB
Motif
Pfam: Rep_fac-A_3
Other DBs
NCBI-GeneID: 824429
NCBI-ProteinID: NP_001078273
TAIR: AT3G52630
UniProt: Q9LXK1 A0A178VHV6
Position
3:19513937..19514868
AA seq 107 aa
MDTSSPSAFVNGALLRRFIGQKVRTVIQVTGSEIGSVVGKSTDDLQIVVRGSSPPSPLTT
YLEVIGIAESDNAIRAETWTNFGNTFDTQNYNELCKLANGEFKHLFI
NT seq 324 nt   +upstreamnt  +downstreamnt
atggatacttcaagtccttcagcttttgtgaacggagctttgttgaggagattcattggc
caaaaagtcagaactgtgattcaagtgactggttcagagattggatctgtggttggcaaa
tctactgatgatcttcagatcgttgttagaggatcgtctcctccttctcctcttactact
taccttgaggttattggaattgcagagagtgataacgctattcgagctgaaacttggacc
aattttggcaacacttttgatacacagaactacaacgagctatgtaagctagcaaatggg
gagttcaagcacttgttcatctaa

KEGG   Arabidopsis thaliana (thale cress): AT4G18590
Entry
AT4G18590         CDS       T00041                                 
Name
(RefSeq) Nucleic acid-binding, OB-fold-like protein
  KO
K10740  replication factor A3
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03030  DNA replication
ath03420  Nucleotide excision repair
ath03430  Mismatch repair
ath03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AT4G18590
   03420 Nucleotide excision repair
    AT4G18590
   03430 Mismatch repair
    AT4G18590
   03440 Homologous recombination
    AT4G18590
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ath03032]
    AT4G18590
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT4G18590
DNA replication proteins [BR:ath03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    AT4G18590
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     AT4G18590
   MMR (mismatch excision repair)
     AT4G18590
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     AT4G18590
SSDB
Motif
Pfam: Rep_fac-A_3
Other DBs
NCBI-GeneID: 827591
NCBI-ProteinID: NP_567560
TAIR: AT4G18590
UniProt: Q6NLG7 A0A178V2X5
Position
4:10236161..10237268
AA seq 106 aa
MDTSSPAAFVNGALLRRYIGQKVRAVIQVIRSDVGSVIGKSTDDQQIVVKGSPQPPLTTY
LEVIGIAETDNTIRAEVWTNFGDSFDVQNYNELCKLANGEFRHLFI
NT seq 321 nt   +upstreamnt  +downstreamnt
atggatacatcaagtcctgctgcttttgtgaatggagctttgttgagaaggtacattggt
cagaaagtgagagcagtgattcaagttatcagatcagatgttggatcagtgattggtaaa
tcgactgatgatcaacagattgttgttaaaggttctcctcaaccgcctttaactacttac
cttgaggtaattggaattgctgagactgacaacactattcgtgctgaagtttggaccaac
tttggtgatagtttcgatgtgcaaaactacaatgagctatgtaagcttgcaaatggtgag
tttagacacttgttcatctaa

KEGG   Arabidopsis thaliana (thale cress): AT4G19130
Entry
AT4G19130         CDS       T00041                                 
Name
(RefSeq) Replication factor-A protein 1-like protein
  KO
K07466  replication factor A1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03030  DNA replication
ath03420  Nucleotide excision repair
ath03430  Mismatch repair
ath03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AT4G19130
   03420 Nucleotide excision repair
    AT4G19130
   03430 Mismatch repair
    AT4G19130
   03440 Homologous recombination
    AT4G19130
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT4G19130
   03032 DNA replication proteins [BR:ath03032]
    AT4G19130
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT4G19130
Transcription factors [BR:ath03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    AT4G19130
DNA replication proteins [BR:ath03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    AT4G19130
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     AT4G19130
   MMR (mismatch excision repair)
     AT4G19130
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     AT4G19130
SSDB
Motif
Pfam: Rep_fac-A_C Rep-A_N REPA_OB_2 tRNA_anti-codon CDC24_OB3 BRCA-2_OB1
Other DBs
NCBI-GeneID: 827651
NCBI-ProteinID: NP_567576
TAIR: AT4G19130
UniProt: F4JSG3
Position
4:complement(10466407..10469329)
AA seq 784 aa
MEVSLTAGAIGKIMNGEVTTEADMIPVLQVTDLKQIMAQQDPTRERFRMVLSDGTYLHQG
MLGTDLNNLVKEGTLQPGSIVRLTRFVGDVIKGRRIVIVPQLEVLKQISDIIGHPVPGGK
HNDQRGADSGIKFNTTEQQGSGIRQVNNIEPGRSNAAISPQVGGTGSSVPASTTPSTRAY
SNPSSGNGVTRQDYARDPPTSYPHQPQPPPPMYANRGPVARNEAPPKIIPVNALSPYSGR
WTIKARVTNKAALKQYSNPRGEGKVFNFDLLDADGGEIRVTCFNAVADQFYDQIVVGNLY
LISRGSLRPAQKNFNHLRNDYEIMLDNASTIKQCYEEDAAIPRHQFHFRTIGDIESMENN
CIVDVIGIVSSISPTVTITRKNGTATPKRSLQLKDMSGRSVEVTMWGDFCNAEGQRLQSL
CDSGVFPVLAVKAGRISEFNGKTVSTIGSSQLFIDPDFVEAEKLKNWFEREGKSVPCISL
SREFSGSGKVDVRKTISQIKDEKLGTSEKPDWITVSATILYLKFDNFCYTACPIMNGDRP
CSKKVTDNGDGTWRCEKCDKSVDECDYRYILQLQIQDHTDLTCVTAFQEAGEEIMGISAK
DLYYVKNEHKDEEKFEDIIRKVAFTKYNFKLKVKEETFSDEQRVKATVVKVDKLNYSADT
RTMLGAMDKLRTRDANSLPINPEGSDYNADVVNTGIGSSGTRDPSSVQRRDFGLHAHQSG
QSGNHYSGGGATTSCNVCGNSGHVSAKCPGATKPQEQGQYMGGSYRGTTGSYGGGLPRQH
VGSY
NT seq 2355 nt   +upstreamnt  +downstreamnt
atggaggtaagtttgacggcgggagcaatcgggaagataatgaatggagaagtgacgact
gaagcagatatgattccggtgttgcaagtgacggatttgaagcagattatggctcaacaa
gatccaacaagagagaggtttaggatggtgttatctgatgggacatacttgcatcaagga
atgctaggaactgatctcaacaatcttgtcaaagaagggactcttcaacccggttctatt
gttagacttactcgtttcgtcggtgatgtcatcaagggtcgaaggattgttattgttccg
caactggaggtgttaaaacagatttctgatattatcgggcatcctgttccaggaggaaag
cataatgatcaacgtggagcagattctggtattaagtttaatacaactgagcaacaaggt
agtggtatccgtcaagtaaacaatatcgagccagggagaagtaatgcagctatttcacct
caggttggtggtactggttctagtgttcctgcatcaacaacaccttccactcgggcatac
agcaatccgtcttcaggtaatggagtcactaggcaggactatgctcgtgatcctccaaca
agttatcctcatcagcctcaaccaccaccaccgatgtatgcaaacaggggaccagtggct
aggaatgaagcacctcctaagataattccagttaatgctcttagtccatattcaggtagg
tggaccatcaaggccagagtcacgaataaagcagcacttaagcaatacagtaatccccgt
ggggaagggaaagtgttcaactttgatcttcttgatgctgatggcggagaaatacgtgtt
acttgttttaacgctgtggctgatcaattctatgaccagattgttgttggtaatctttat
cttatctcgaggggaagtttgcggcctgcacaaaagaactttaatcatcttcgaaatgat
tacgagatcatgctggataatgcatcaactataaaacaatgctatgaagaggatgctgca
attccgcgccatcagttccatttccgtaccattggggatattgagagcatggagaataac
tgcatcgttgatgtaattggtattgtgtcatctatcagtcctactgtaacaataacgagg
aaaaacggaactgcaacaccgaaaagatcacttcagttgaaggatatgtcaggccgaagt
gttgaggtaactatgtggggtgacttctgcaatgcagaaggacaaaggctgcaaagtctt
tgtgattctggtgtgtttccggttcttgctgttaaggcgggcaggattagtgaatttaat
ggaaagacagtgagcaccattggatcaagtcagctgttcattgacccagattttgttgaa
gctgagaaactgaagaactggtttgagagagaaggaaagagtgtcccttgtatctcctta
tctcgggagttttccggcagtggcaaagtagatgttcgtaagacaatatctcaaattaaa
gatgagaaactaggaacctccgaaaaaccagactggatcacagtcagtgccacaatttta
tacttgaagtttgataacttctgctacacagcttgtcctatcatgaacggtgatcgtcca
tgcagcaaaaaggtaacagacaatggagatgggacatggcggtgcgaaaagtgtgataaa
agcgttgatgaatgtgactacaggtatatactgcagcttcagatacaggaccatacagat
cttacttgcgtcacagcattccaggaggctggtgaagagataatgggcatatctgctaaa
gatttgtattatgtgaagaatgaacacaaggatgaggaaaaattcgaagatatcatccgt
aaggttgcttttaccaagtacaacttcaagctgaaggtaaaagaagaaacattcagcgac
gaacagcgtgtgaaagcaacagttgtgaaagtggacaagctaaactattcagcagatacc
aggactatgttaggtgctatggataaactcaggaccagagatgcaaattctcttcccatt
aacccagaaggatccgattacaatgctgatgtggttaatactggtataggaagctcagga
accagagatccctcatcggtccaaagaagggatttcggtttacatgcgcatcaatcgggt
caatctgggaatcactatagtggtggtggtgctactactagctgcaatgtctgtggaaac
agtggtcatgtttctgcaaagtgtccaggcgctactaagccgcaagagcaagggcagtac
atgggtggctcttacagaggcacgacggggagttatggaggaggactaccgagacaacat
gttggaagctactga

KEGG   Arabidopsis thaliana (thale cress): AT5G08020
Entry
AT5G08020         CDS       T00041                                 
Symbol
RPA70B
Name
(RefSeq) RPA70-kDa subunit B
  KO
K07466  replication factor A1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03030  DNA replication
ath03420  Nucleotide excision repair
ath03430  Mismatch repair
ath03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AT5G08020 (RPA70B)
   03420 Nucleotide excision repair
    AT5G08020 (RPA70B)
   03430 Mismatch repair
    AT5G08020 (RPA70B)
   03440 Homologous recombination
    AT5G08020 (RPA70B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT5G08020 (RPA70B)
   03032 DNA replication proteins [BR:ath03032]
    AT5G08020 (RPA70B)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT5G08020 (RPA70B)
Transcription factors [BR:ath03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    AT5G08020 (RPA70B)
DNA replication proteins [BR:ath03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    AT5G08020 (RPA70B)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     AT5G08020 (RPA70B)
   MMR (mismatch excision repair)
     AT5G08020 (RPA70B)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     AT5G08020 (RPA70B)
SSDB
Motif
Pfam: Rep_fac-A_C Rep-A_N REPA_OB_2 tRNA_anti-codon DUF223
Other DBs
NCBI-GeneID: 830696
NCBI-ProteinID: NP_196419
TAIR: AT5G08020
UniProt: Q9SD82 A0A178UED9
Position
5:2571957..2575061
AA seq 604 aa
MENSVTQDGIATVLANQSLDSSSVRPEIVVQVVDLKPAGNRYTFSANDGKMKIKAMLPAT
LTSDIISGKIQNLGLIRLLEYTVNDIPGKSEEKYMLITKCEAVASALDSEIKAEIKASTG
IMLKPKHEFVAKSASQIINEQRGNAAPAARMAMTRRVHPLVSLNPYQGSWTIKVRVTNKG
VMRTYKNARGEGCVFNVELTDEEGTQIQATMFNAAARKFYDRFEMGKVYYISRGSLKLAN
KQFKTVQNDYEMTLNENSEVEEASNEEMFTPETKFNFVPIDELGTYVNQKDLIDVIGVVQ
SVSPTMSIRRKNDNEMIPKRDITLADETKKTVVVSLWNDLATGIGQELLDMADNHPVIAI
KSLKVGAFQGVSLSTISRSNVVINPNSPEATKLKSWYDAEGKETSMSAIGSGMSSSANNG
SRSMYSDRVFLSHITSNPSLGEEKPVFFSTRAYISFIKPDQTMWYRACKTCNKKVTEAMD
SGYWCESCQKKDQECSLRYIMAVKVSDSTGETWLSAFNDEAEKIIGCTADDLNDLKSEEG
EVNEFQTKLKEATWSSHLFRISVSQQEYNSEKRQRITVRGVSPIDFAAETRLLLQDISKN
KTSQ
NT seq 1815 nt   +upstreamnt  +downstreamnt
atggagaactcagtgacccaagatggtatcgcgacagtattagccaatcaatcccttgat
tcctcctctgttagacccgaaattgttgttcaagtcgtggatcttaagcctgctggaaat
cgatatacgtttagtgccaatgatggaaagatgaagattaaagcaatgttaccagcgact
ttgacttctgatatcatctctggaaagattcagaatctgggtcttattcgtctccttgag
tataccgtcaatgatattccaggcaaatcagaagaaaaatatatgcttataacaaaatgt
gaggctgttgcttctgcacttgactcagagattaaggcggagattaaagcttccacaggc
ataatgttgaaacccaagcatgagtttgttgccaaatcagcttcacagattatcaatgag
caaaggggaaatgctgcacctgctgcaagaatggctatgaccagaagggttcatcctctt
gtgtccttgaacccttatcaaggaagttggactattaaagttcgtgtcactaacaaagga
gtcatgagaacttacaaaaatgccagaggagaaggatgtgtgtttaatgtggaactaact
gatgaggaaggaacacagattcaggcaacaatgtttaacgcagctgcaaggaagttttat
gacagattcgagatgggaaaggtgtactatatatccaggggatcacttaagcttgctaat
aagcagttcaagacggttcagaacgattatgagatgaccctaaatgagaattctgaggtt
gaagaagctagtaatgaagaaatgtttacccctgaaactaaattcaactttgtacccatt
gatgagttgggtacatacgtgaatcagaaagaccttattgatgttatcggtgttgttcaa
agtgtttctcctaccatgagcattagaaggaagaacgacaatgagatgatcccaaagaga
gatataactttggctgatgagacaaagaaaactgttgtggtgtccctttggaatgatcta
gcaactggcattggccaagaactgctggacatggctgataatcaccctgttatcgcgatt
aaatctcttaaagttggagcttttcaaggtgtttcattgtctactatcagcagaagcaat
gtggtgataaaccctaattctccagaagctacaaagttgaaatcttggtatgatgctgaa
gggaaagagacatctatgtctgctattggttctgggatgagttcttctgccaacaacgga
tcaagatccatgtattctgacagagtttttctttctcacatcacaagcaatccctcttta
ggcgaggagaagcctgtattcttcagcactagagcttacataagcttcatcaagccagac
caaacaatgtggtaccgtgcttgcaagacctgtaacaagaaagttactgaagcaatggac
tctggttattggtgtgaaagttgtcagaaaaaggaccaagaatgcagtttaaggtatata
atggcggtgaaagtctccgactcaactggtgaaacttggttatctgcattcaatgatgaa
gcagagaagattatcggctgcacagctgatgatctcaatgatctaaaatcagaggaaggt
gaagtgaatgagtttcagacaaaactgaaagaagctacttggtcatctcatctcttccgg
attagtgtttctcagcaagagtataacagtgagaagagacagaggataactgtaagaggt
gtttctccaattgactttgctgctgaaacaagattattgctccaagacatttccaagaac
aagacatctcagtaa

KEGG   Arabidopsis thaliana (thale cress): AT5G45400
Entry
AT5G45400         CDS       T00041                                 
Symbol
RPA70C
Name
(RefSeq) Replication factor-A protein 1-like protein
  KO
K07466  replication factor A1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03030  DNA replication
ath03420  Nucleotide excision repair
ath03430  Mismatch repair
ath03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AT5G45400 (RPA70C)
   03420 Nucleotide excision repair
    AT5G45400 (RPA70C)
   03430 Mismatch repair
    AT5G45400 (RPA70C)
   03440 Homologous recombination
    AT5G45400 (RPA70C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT5G45400 (RPA70C)
   03032 DNA replication proteins [BR:ath03032]
    AT5G45400 (RPA70C)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT5G45400 (RPA70C)
Transcription factors [BR:ath03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    AT5G45400 (RPA70C)
DNA replication proteins [BR:ath03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    AT5G45400 (RPA70C)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     AT5G45400 (RPA70C)
   MMR (mismatch excision repair)
     AT5G45400 (RPA70C)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     AT5G45400 (RPA70C)
SSDB
Motif
Pfam: Rep_fac-A_C Rep-A_N REPA_OB_2 tRNA_anti-codon CDC24_OB3 BRCA-2_OB1 Fer4_10
Other DBs
NCBI-GeneID: 834576
NCBI-ProteinID: NP_199353
TAIR: AT5G45400
UniProt: Q9FHJ6 A0A654G8I4
Position
5:18398832..18402284
AA seq 853 aa
MAVSLTEGVVMKMLNGEVTSETDMMPVLQVTELKLIQSKLHQNQESSNRYKFLLSDGTDL
AAGMLNTSLNSLVNQGTIQLGSVIRLTHYICNLIQTRRIVVIMQLEVIVEKCNIIGNPKE
PGHSSINPQRGGVNTQSNGGSEQQQARRSDVNGGRYGVSANSPQPQVVHNSSDAGRYCVS
ANSPQPQVVHSSSDAGRYGVSANSPQRQVVHNSPDAGRYGQPQVSQRYGTGSGYPETSPS
TRPYVSSNAGYGGSRQDQPRAPTATTAYSRPVQSAYQPQQPPMYVNRGPVARNEAPPRIN
PIAALNPYQGRWTIKVRVTSKADLRRFNNPRGEGKLFSFDLLDADGGEIRVTCFNDAVDQ
FFDKIVVGNVYLISRGNLKPAQKNFNHLPNDYEIHLDSASTIQPCEDDGTIPRYHFHFRN
IGDIENMENNSTTDVIGIVSSISPTVAIMRKNLTEVQKRSLQLKDMSGRSVEVTMWGNFC
NAEGQKLQNLCDSGVFPVLALKAGRIGEFNGKQVSTIGASQFFIEPDFPEARELRQWYER
EGRNAHFTSISREFSGVGRQEVRKVIAQIKDEKLGTSEKPDWITVCATISFMKVENFCYT
ACPIMNGDRPCSKKVTNNGDGTWRCEKCDKCVDECDYRYILQIQLQDHTDLTWATAFQEA
GEEIMGMSAKDLYYVKYENQDEEKFEDIIRSVAFTKYIFKLKIKEETYSDEQRVKATVVK
AEKLNYSSNTRFMLEAIDKLKIGDANSLPIKAESSNYRSDAFNSGVGTSGTRDTASVDAR
REFGLPAANQVGQYGNQYSSDARSLGGFTSCNVCRSNSHVSANCPTLMSEPQGQYMGGTN
AGGGMPRQHVGSY
NT seq 2562 nt   +upstreamnt  +downstreamnt
atggcggtgagtttgacggagggagtggtaatgaagatgttgaacggagaagtgacgagc
gagacagatatgatgccagtgctacaagtaacggaattgaagctgattcagagcaagctt
catcaaaatcaggaatctagcaatcgatataagtttttattatcagatgggactgacttg
gcagcaggaatgcttaatacttcattgaacagtttagtgaatcaaggaactattcaattg
ggttcggttataagactcactcactacatctgcaatctcatccagactcgaaggattgtt
gttattatgcaattggaggttattgtggagaaatgtaatataattggaaatcctaaagaa
cctgggcatagctcgattaatccacaacgtggtggagttaacacacaaagcaatggtggt
tctgagcagcaacaagctagaaggagtgatgtgaatggtgggagatacggtgtatcggct
aattcgcctcaacctcaagttgttcataacagttccgacgctggaagatactgtgtatcg
gctaattcacctcagcctcaagttgttcatagcagttccgacgctggaagatatggtgta
tcggctaattcacctcagcgtcaagttgttcataacagtcccgacgctgggagatatgga
cagcctcaagttagtcaaagatatggtactggttctggttatccggaaacatcaccttcc
actagaccgtatgtgagctcaaatgcaggttatggaggctctaggcaggaccaacctcgg
gctcctactgcaacaactgcttattcccgtccggttcagtcagcttatcagccacaacaa
ccaccgatgtatgttaacaggggacctgtggctaggaacgaagctcctccgaggataaat
ccgattgctgctcttaatccttaccagggtcggtggaccatcaaggttagggtcacgagt
aaggcagacctgaggcggtttaataatccgcgtggggaagggaagttgttcagttttgat
cttcttgatgctgatggtggagaaatacgggtgacttgttttaatgatgcggttgatcaa
ttctttgacaagattgtagttggtaatgtttatctgatttcaaggggaaatttgaagcct
gctcagaagaactttaatcatcttccgaatgattatgaaatacatttggactctgcatca
acgatacagccttgtgaagatgatggtaccattccacgctatcatttccattttcgtaac
ataggtgatattgaaaacatggagaacaacagcaccactgatgtaattggtattgtttcg
tccatcagtccgacagtagcaattatgcggaaaaacttaactgaggtacagaaaaggtct
cttcagttgaaggatatgtcaggccgaagtgttgaggtaaccatgtggggtaatttctgc
aacgcagaaggacagaaattgcaaaatctttgtgattctggggtattcccggttcttgct
ttgaaagcgggcaggatcggtgaattcaacgggaagcaagtgagcacaattggagcaagt
caattctttatagagccagatttccctgaagccagagaattaaggcaatggtatgagaga
gaaggaaggaatgctcattttacctccatatctagagagttttccggtgttggcagacaa
gaagttcgcaaggtaattgcacagatcaaggacgagaagctagggacctcagagaagccg
gactggatcacagtctgtgccaccatttcattcatgaaggttgaaaatttctgctatacg
gcttgtcctatcatgaatggagatcgtccatgcagcaaaaaggtcacaaataacggagat
gggacatggcgttgtgagaagtgtgacaaatgcgtggatgaatgtgactacaggtatata
ttacagatccagttacaggaccatacagacctaacctgggcaactgcattccaagaagct
ggtgaagagataatgggaatgtctgcaaaagatttgtattatgtgaagtatgaaaatcag
gatgaggagaaatttgaagatatcatccgcagtgtcgcttttactaagtacattttcaag
ctgaagattaaagaagaaacttacagcgatgagcagcgggttaaagcaacagttgtgaaa
gctgaaaagctgaattattcttcaaataccaggttcatgctagaggcaatagataaactc
aagataggagatgcaaattctctccctataaaggcagagagttccaattacaggtctgat
gcatttaattccggtgttggaacctcaggaactagagacaccgcatcagtcgatgcacgc
agagaatttggattacctgcagcaaaccaagtgggtcaatatggaaatcagtacagtagt
gatgcaaggtctcttggcggttttactagctgcaacgtgtgtcgcagcaacagccatgtt
tctgcaaactgcccaacccttatgagtgagccacaaggacaatacatgggtggcacaaat
gcaggaggaggtatgccaaggcaacatgtaggcagctactga

KEGG   Arabidopsis thaliana (thale cress): AT5G61000
Entry
AT5G61000         CDS       T00041                                 
Symbol
RPA70D
Name
(RefSeq) Replication factor-A protein 1-like protein
  KO
K07466  replication factor A1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03030  DNA replication
ath03420  Nucleotide excision repair
ath03430  Mismatch repair
ath03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AT5G61000 (RPA70D)
   03420 Nucleotide excision repair
    AT5G61000 (RPA70D)
   03430 Mismatch repair
    AT5G61000 (RPA70D)
   03440 Homologous recombination
    AT5G61000 (RPA70D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT5G61000 (RPA70D)
   03032 DNA replication proteins [BR:ath03032]
    AT5G61000 (RPA70D)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT5G61000 (RPA70D)
Transcription factors [BR:ath03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    AT5G61000 (RPA70D)
DNA replication proteins [BR:ath03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    AT5G61000 (RPA70D)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     AT5G61000 (RPA70D)
   MMR (mismatch excision repair)
     AT5G61000 (RPA70D)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     AT5G61000 (RPA70D)
SSDB
Motif
Pfam: Rep_fac-A_C Rep-A_N REPA_OB_2 tRNA_anti-codon DUF223 CDC24_OB3 zf-RRPl_C4 DUF5651
Other DBs
NCBI-GeneID: 836221
NCBI-ProteinID: NP_200908
TAIR: AT5G61000
UniProt: Q9FME0 A0A178UJ91
Position
5:complement(24549479..24552855)
AA seq 629 aa
MQTSVTPDAISTVLSNPSFDSSSDRSEIVVQVVDLKPIGNRYTFSANDGKTKVKAMFTAS
LTPEIISGKIQNLGLIRLIDFTVNDISSKSTKYFLVTKCEAVGSVLDSEINLDSKSGEEE
AREPKKQKLEHSPVSPLNDVVSTGITLKPKQEFVAKSASQIMSEQRGNAAPAARMAMTRR
VHPLVSLNPYQGNWTIKVRVTNKGVMRNYKNARGEGCVFNVELTDEEGTQIQATMFNDAA
RKFFDRFQLGKVYYISRGSLKLANKQFKTVQNDYEMTLNENSEVEEASSEEMFIPETKFN
FVPIEELGLYVNQKELIDLIGVVQSVSPTMSIRRRTDNEMIPKRDITLADESRKTVVVSL
WNDLATGIGQELLDMADQSPVIAIKSLKVGDFQGVSLSTISRSNVVINPESPEAKKLKSW
FDSEGKEISMSSIGSGMSPSAKNGSRSLYTDRVLLSHITSNPSLFEEKPVFFSTRAYISF
IKPDQTMWYQACKTCNKKVTEALDSGYWCEGCQRKYEECSLRYIMAVKVTDSSGETWISS
FNDEAEKILGCSADELNKLKSEEGEVNEYQTKLKEATWSSHVFRVSVTQNEYNGEKRQRV
TVKGVAPLDFAAETRLLLQDISNKNKTSQ
NT seq 1890 nt   +upstreamnt  +downstreamnt
atgcagacttcggtgaccccagatgccatctccaccgttttgtcaaacccatcctttgat
tcgtcttccgatcgatctgagatcgttgttcaagttgtggatcttaaacctatcggcaat
cgctatacatttagtgcaaatgacggaaagacgaaagtcaaagcaatgtttactgcttca
ctcacacctgaaatcatttctgggaagatccagaacttgggtctaattcgtctcattgat
ttcactgttaacgacatttcaagcaaatctacaaaatatttccttgtgactaaatgtgag
gctgttggttctgtgcttgattctgagattaacttggacagtaagagcggagaggaggag
gctcgtgagcccaagaagcagaaactagagcattctcctgtcagtcctctgaatgatgtt
gtttctactggtatcacattgaaaccgaagcaggaatttgtagccaaatcagcttctcag
ataatgagtgaacaaaggggaaatgctgcaccagctgcaagaatggccatgactagaagg
gttcatccacttgtgtcattaaatccatatcaaggaaactggaccatcaaagtccgagtt
acaaacaagggagtgatgagaaattacaaaaacgctaggggtgaaggatgtgtcttcaat
gttgaactaacagatgaagaaggaacacaaattcaagcaacgatgtttaatgatgctgca
aggaagttttttgacagattccagttgggaaaggtttattatatatcaagggggtcacta
aaactcgctaacaagcagttcaaaacagttcagaatgattatgagatgacactgaatgaa
aattcagaggttgaggaagctagtagcgaagaaatgttcatccctgagacaaaattcaac
ttcgtacccattgaagagttgggtctgtatgttaatcagaaggaacttattgatcttatt
ggagttgttcaaagtgtatctcctaccatgagtattagaaggagaactgacaatgagatg
attcctaagagggatataactttggctgatgagtcaaggaaaactgttgtggtgtccctg
tggaatgatcttgcaactggcataggtcaggagctactagacatggctgatcagtcacct
gtgattgcaatcaagtctctcaaagttggagattttcaaggtgtttcgttgtctaccatc
agcagaagcaatgtggttattaacccggaatcaccagaagctaaaaagttgaaatcttgg
tttgattctgaaggcaaggaaatatccatgtcttctattggctcagggatgagcccttct
gccaaaaatggatctcggtctttgtatactgaccgagtgcttctctctcacatcacaagc
aatccatctttattcgaagaaaagcctgtatttttcagcactagggcttacataagcttc
atcaaaccagaccaaacaatgtggtaccaagcttgtaagacttgtaacaagaaagtgaca
gaagcacttgactctggttactggtgtgaaggatgccagagaaagtatgaagaatgcagc
ttaaggtacataatggcggtgaaagtcaccgactcatctggagaaacttggatttcgtca
ttcaacgatgaagcagagaagattcttggatgttcagctgatgagctcaacaaactaaaa
tcagaggaaggtgaagtaaatgaatatcagacaaaactgaaagaggcaacatggtcatct
catgtcttccgggttagtgtcacacagaatgagtataacggtgagaagagacagagggta
actgtaaaaggagtagctcctcttgattttgctgctgaaacaagattgttgcttcaagac
atctccaacaagaacaaaacatctcagtag

DBGET integrated database retrieval system