KEGG   Arabidopsis thaliana (thale cress): AT2G14170
Entry
AT2G14170         CDS       T00041                                 
Symbol
ALDH6B2
Name
(RefSeq) aldehyde dehydrogenase 6B2
  KO
K00140  malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00280  Valine, leucine and isoleucine degradation
ath00410  beta-Alanine metabolism
ath00562  Inositol phosphate metabolism
ath00640  Propanoate metabolism
ath01100  Metabolic pathways
ath01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AT2G14170 (ALDH6B2)
   00562 Inositol phosphate metabolism
    AT2G14170 (ALDH6B2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AT2G14170 (ALDH6B2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT2G14170 (ALDH6B2)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     AT2G14170 (ALDH6B2)
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     AT2G14170 (ALDH6B2)
SSDB
Motif
Pfam: Aldedh DUF3387
Other DBs
NCBI-GeneID: 815903
NCBI-ProteinID: NP_179032
TAIR: AT2G14170
UniProt: Q0WM29
Position
2:complement(5977272..5981899)
AA seq 607 aa
MVRVKQKNLESYRSNGTYPPTWRNPTTSFAPDQHRVSIHSSLKSKTKRRRLYKEADDNTK
LRSSSSTTTTTTTMLLRISGNNLRPLRPQFLALRSSWLSTSPEQSTQPQMPPRVPNLIGG
SFVESQSSSFIDVINPATQEVVSKVPLTTNEEFKAAVSAAKQAFPLWRNTPITTRQRVML
KFQELIRKNMDKLAMNITTEQGKTLKDSHGDIFRGLEVVEHACGMATLQMGEYLPNVSNG
VDTYSIREPLGVCAGICPFNFPAMIPLWMFPVAVTCGNTFILKPSEKDPGASVILAELAM
EAGLPDGVLNIVHGTNDTVNAICDDEDIRAVSFVGSNTAGMHIYARAAAKGKRIQSNMGA
KNHGLVLPDANIDATLNALLAAGFGAAGQRCMALSTVVFVGDAKSWEDKLVERAKALKVT
CGSEPDADLGPVISKQAKERICRLIQSGVDDGAKLLLDGRDIVVPGYEKGNFIGPTILSG
VTPDMECYKEEIFGPVLVCMQANSFDEAISIINKNKYGNGAAIFTSSGAAARKFQMDIEA
GQIGINVPIPVPLPFFSFTGNKASFAGDLNFYGKAGVDFFTQIKTVTQQWKDIPTSVSLA
MPTSQKQ
NT seq 1824 nt   +upstreamnt  +downstreamnt
atggtgagagtcaaacaaaagaatcttgaatcttatagatctaacggtacatatccaccc
acgtggcgaaatccaaccacttcattcgcacccgatcaacatcgagtcagcattcactca
tcactcaaatccaaaaccaaaaggagacgcttatacaaagaagcagacgacaacaccaaa
ctccgatcatcatcatcaacaacaacaacaacaacaacgatgctgcttcgaatttctggt
aacaatctgagacctttgagaccacaatttctcgctcttcgaagctcttggttatcaact
tcgccggagcaatctactcaaccacaaatgcctccgagagtaccaaatcttattggaggt
tcttttgttgagtctcaatcatcttcgtttatcgatgttataaaccctgctacacaagag
gttgtatctaaagttccattgactactaatgaagagtttaaagctgcggtatccgctgcg
aagcaagcgtttccgttgtggagaaacacgccgattactacccggcagcgtgttatgcta
aagtttcaagagcttatacgcaagaatatggataaacttgctatgaacatcacaaccgag
caagggaagactttaaaggattcacatggtgatatcttccgtgggttagaggttgtggag
catgcgtgtggaatggcaaccttacagatgggtgaatatctccccaatgtgtcgaacgga
gttgatacatatagtattagagagccattaggtgtttgtgctggcatttgtccttttaac
tttccagccatgattcctttatggatgtttcctgttgcagtgacatgtggtaataccttt
attctgaagccatcagagaaggatcccggtgcttctgtaatacttgccgagttggcaatg
gaagctggtttacctgatggggttctcaatatcgttcacggaaccaatgatactgtgaat
gctatctgtgatgatgaagatataagggctgtttcttttgttggctccaacacggctgga
atgcatatatacgcaagagcagcagcaaaaggaaaacgtattcagtcaaatatgggggcg
aaaaatcatggacttgtcttgcctgatgccaacatcgatgcaactttaaatgcgctactt
gctgctgggtttggtgccgctggacagagatgcatggcactgagtacagtggtttttgtt
ggcgatgcaaaatcatgggaggataaactcgttgagcgagctaaggcccttaaagtcaca
tgtgggtcagaaccagatgcagacctgggtcctgtgattagtaaacaggcgaaagaacgg
atatgccggttgattcagtctggtgtagatgatggtgctaaattgctgcttgacggaaga
gatattgtggttccaggatatgagaaagggaattttatcggtcctaccattctatctggt
gttaccccagacatggagtgttacaaggaggaaatatttggccctgttcttgtgtgcatg
caggcaaacagttttgatgaggccatatctataataaataaaaacaagtatgggaacggt
gctgcgattttcacgtcgtccggggcagcagcaagaaagttccagatggacatagaagca
ggacagatcggtattaatgttccaatcccggttccattaccgttcttttccttcaccggg
aacaaggcctcattcgcaggagatcttaacttctatggcaaagcaggagtggactttttc
actcagatcaaaactgttacacaacagtggaaagatattccaacttcagtatctctggca
atgccaacgtctcaaaagcaataa

DBGET integrated database retrieval system