KEGG   Arabidopsis thaliana (thale cress): AT2G15400
Entry
AT2G15400         CDS       T00041                                 
Symbol
NRPE3B
Name
(RefSeq) DNA-directed RNA polymerase family protein
  KO
K03011  DNA-directed RNA polymerase II subunit RPB3
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT2G15400 (NRPE3B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT2G15400 (NRPE3B)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT2G15400 (NRPE3B)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     AT2G15400 (NRPE3B)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      AT2G15400 (NRPE3B)
SSDB
Motif
Pfam: RNA_pol_A_bac RNA_pol_L SAM_HAT_N
Other DBs
NCBI-GeneID: 816032
NCBI-ProteinID: NP_179142
TAIR: AT2G15400
UniProt: Q39212 A0A384LLK9 Q0WRA4
Position
2:6712895..6714609
AA seq 319 aa
MDGVTYQRFPTVKIRELKDDYAKFELRETDVSMANALRRVMISEVPTMAIHLVKIEVNSS
VLNDEFIAQRLSLIPLTSERAMSMRFCQDCEDCNGDEHCEFCSVEFPLSAKCVTDQTLDV
TSRDLYSADPTVTPVDFTSNSSTSDSSEHKGIIIAKLRRGQELKLKALARKGIGKDHAKW
SPAATVTYMYEPDIIINEEMMNTLTDEEKIDLIESSPTKVFGIDPVTGQVVVVDPEAYTY
DEEVIKKAEAMGKPGLIEIHPKHDSFVFTVESTGALKASQLVLNAIDILKQKLDAIRLSD
NTVEADDQFGELGAHMREG
NT seq 960 nt   +upstreamnt  +downstreamnt
atggacggtgtcacctaccaaagattcccaacggtgaagatccgtgagcttaaagatgac
tacgccaagttcgagcttcgtgaaaccgacgtttcaatggccaacgctctccgtcgcgta
atgatctccgaagtccccaccatggcaatccatctcgtcaaaatcgaggttaattcctct
gttctcaacgacgagttcattgctcaacgacttagtctcatccctctcactagcgagcgt
gctatgagcatgcggttctgtcaagattgtgaagattgtaatggagatgaacattgcgag
ttctgctctgttgagtttccccttagtgctaagtgtgttactgaccaaaccctagatgtt
actagtagggatctctacagtgctgatcctactgttactcctgttgatttcactagtaac
tcatctacttctgattcaagcgagcacaagggaattatcattgcgaaactacgcagggga
caagagttgaagcttaaagcattagctaggaaaggaattgggaaagatcatgcgaaatgg
tctcctgcagctactgttacgtatatgtatgagcctgacattattatcaatgaagagatg
atgaacactttgacagatgaggaaaaaattgacttgattgagagcagtcctaccaaagtg
tttggcattgacccagtcaccggacaggttgtggtggttgatcctgaagcatacacttac
gatgaagaagtgatcaagaaagctgaagcaatggggaaaccgggactcattgagatccat
ccgaaacatgatagttttgtattcactgttgagtccacaggtgcattgaaggcttctcag
ctggtactaaatgccattgatatcctgaagcagaagcttgatgcaatccgtctctcagat
aacactgtagaagccgatgatcagtttggtgaactcggtgcccatatgcgtgaaggatga

KEGG   Arabidopsis thaliana (thale cress): AT2G15430
Entry
AT2G15430         CDS       T00041                                 
Symbol
NRPB3
Name
(RefSeq) DNA-directed RNA polymerase family protein
  KO
K03011  DNA-directed RNA polymerase II subunit RPB3
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT2G15430 (NRPB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT2G15430 (NRPB3)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT2G15430 (NRPB3)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     AT2G15430 (NRPB3)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      AT2G15430 (NRPB3)
SSDB
Motif
Pfam: RNA_pol_A_bac RNA_pol_L
Other DBs
NCBI-GeneID: 816035
NCBI-ProteinID: NP_179145
TAIR: AT2G15430
UniProt: Q39211 A0A178W202
Structure
Position
2:6733534..6735819
AA seq 319 aa
MDGATYQRFPKIKIRELKDDYAKFELRETDVSMANALRRVMISEVPTVAIDLVEIEVNSS
VLNDEFIAHRLGLIPLTSERAMSMRFSRDCDACDGDGQCEFCSVEFRLSSKCVTDQTLDV
TSRDLYSADPTVTPVDFTIDSSVSDSSEHKGIIIVKLRRGQELKLRAIARKGIGKDHAKW
SPAATVTFMYEPDIIINEDMMDTLSDEEKIDLIESSPTKVFGMDPVTRQVVVVDPEAYTY
DEEVIKKAEAMGKPGLIEISPKDDSFIFTVESTGAVKASQLVLNAIDLLKQKLDAVRLSD
DTVEADDQFGELGAHMRGG
NT seq 960 nt   +upstreamnt  +downstreamnt
atggacggtgccacataccaaagattcccaaagatcaagatccgtgagcttaaagatgat
tacgccaagttcgagcttcgtgaaaccgacgtttctatggccaacgctctccgtcgcgta
atgatctccgaagtccctaccgtcgcaatagatctagtcgaaatcgaggttaattcatct
gtactcaacgacgagttcattgctcatcgattaggtctcattcctctcactagcgaacgt
gctatgagcatgcgtttctctcgagattgtgatgcttgtgatggagatggacaatgcgag
ttttgctctgttgagtttcggcttagttctaagtgtgttactgatcaaaccctagatgtt
actagtagggatttgtacagtgctgatcctactgttactcctgtggatttcactattgac
tcgtctgtatctgattcaagcgagcacaagggaattatcattgtgaaactgcgtcgggga
caagagttgaagcttagagcgatagcgaggaaagggattgggaaagatcatgcgaaatgg
tctcctgcagctactgttacgtttatgtatgagcctgacataattattaatgaagatatg
atggatactttgtcagacgaggaaaagatcgacttgattgagagcagtcctaccaaagtg
tttggcatggatccagtcaccagacaggttgtagtggttgatcctgaagcatacacttac
gatgaagaagtgatcaagaaagctgaagcaatggggaaaccgggactcattgagatcagt
ccgaaagatgacagttttatattcactgttgagtccacaggtgcagtgaaggcttcccaa
ctggtactaaatgccattgatcttctgaagcagaagcttgatgcagtccgtctctcagat
gacaccgtagaagcggatgatcagtttggtgaactcggtgcccatatgcgtggaggatga

DBGET integrated database retrieval system