KEGG   Arabidopsis thaliana (thale cress): AT2G18250
Entry
AT2G18250         CDS       T00041                                 
Symbol
COAD
Name
(RefSeq) 4-phosphopantetheine adenylyltransferase
  KO
K02201  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00770  Pantothenate and CoA biosynthesis
ath01100  Metabolic pathways
ath01240  Biosynthesis of cofactors
Module
ath_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT2G18250 (COAD)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     AT2G18250 (COAD)
SSDB
Motif
Pfam: CTP_transf_like FAD_syn Citrate_ly_lig
Other DBs
NCBI-GeneID: 816341
NCBI-ProteinID: NP_179417
TAIR: AT2G18250
UniProt: Q9ZPV8 A0A178VUE8
Position
2:7939822..7941696
AA seq 176 aa
MAAPEDSKMSPANSFGAVVLGGTFDRLHDGHRMFLKAAAELARDRIVVGVCDGPMLTKKQ
FSDMIQPIEERMRNVETYVKSIKPELVVQAEPITDPYGPSIVDENLEAIVVSKETLPGGL
SVNRKRAERGLSQLKIEVVEIVSDGSSGNKISSSTLRKMEAEKASKQKQPAEEKAS
NT seq 531 nt   +upstreamnt  +downstreamnt
atggcagctccggaagattcaaagatgtctccggcgaattcgtttggagctgtcgttctc
ggcggtacgtttgatcgattacacgatgggcatcgaatgttcctcaaggcggcggcggag
ctggccagggatcggatcgtagtgggagtctgtgatggcccaatgttgacgaaaaagcaa
ttctctgacatgattcaacccattgaagaaaggatgcgtaatgtggagacctatgtcaag
tctatcaagcccgagctggttgtacaagccgaacccattacagatccatatggcccttct
atcgtagatgaaaatttggaagctattgttgtcagcaaagagacattacctggtggcttg
tcagttaacagaaaaagagcagaaagaggtctttcacagcttaagattgaagttgtggaa
atagtttctgatggatcgagtggaaataagataagttcaagtactctgagaaaaatggag
gctgagaaagcgtctaaacaaaaacaaccagcagaagaaaaagcatcatga

DBGET integrated database retrieval system