KEGG   Arabidopsis thaliana (thale cress): AT2G27490
Entry
AT2G27490         CDS       T00041                                 
Symbol
ATCOAE
Name
(RefSeq) dephospho-CoA kinase family
  KO
K00859  dephospho-CoA kinase [EC:2.7.1.24]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00770  Pantothenate and CoA biosynthesis
ath01100  Metabolic pathways
ath01240  Biosynthesis of cofactors
Module
ath_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT2G27490 (ATCOAE)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.24  dephospho-CoA kinase
     AT2G27490 (ATCOAE)
SSDB
Motif
Pfam: CoaE AAA_18 AAA_28
Other DBs
NCBI-GeneID: 817294
NCBI-ProteinID: NP_001324076
TAIR: AT2G27490
UniProt: Q9ZQH0 A0A654F7D5
Position
2:complement(11748015..11750488)
AA seq 232 aa
MRIVGLTGGIASGKSTVSNLFKASGIPVVDADVVARDVLKKGSGGWKRVVAAFGEEILLP
SGEVDRPKLGQIVFSSDSKRQLLNKLMAPYISSGIFWEILKQWASGAKVIVVDIPLLFEV
KMDKWTKPIVVVWVSQETQLKRLMERDGLSEEDARNRVMAQMPLDSKRSKADVVIDNNGS
LDDLHQQFEKVLIEIRRPLTWIEFWRSRQGAFSVLGSVILGLSVCKQLKIGS
NT seq 699 nt   +upstreamnt  +downstreamnt
atgagaatagtcgggttaacgggaggcatagcgtctgggaagagtacagtgtctaacctc
ttcaaggctagtggcattcccgttgttgacgctgatgttgttgctcgagatgtattgaag
aaaggaagcggtggatggaaaagagtcgttgcagcttttggtgaggagattctgcttcct
agtggagaagtggatcggccaaaactcggtcagattgtgttctcgtctgattccaagcgt
caacttctaaacaagctgatggctccatacatatcaagtggtatcttctgggaaattctg
aaacaatgggcgagtggagctaaagtgatagttgtcgatatccctttgttgttcgaagtg
aagatggataaatggactaaacctattgtggttgtgtgggttagtcaagagacacaactt
aagagactgatggagagagatggattgagtgaggaagatgcaagaaacagagtgatggct
cagatgccgttggattcgaaaagaagcaaagctgatgttgtgatcgataataatggctct
cttgacgaccttcaccaacagttcgagaaggttttgattgaaattagaagaccattgacg
tggatcgagttttggcgttcaaggcaaggagccttctcggtccttggttcagtgatttta
ggattatctgtttgcaaacagctcaaaattggctcttaa

DBGET integrated database retrieval system