KEGG   Arabidopsis thaliana (thale cress): AT2G29540
Entry
AT2G29540         CDS       T00041                                 
Symbol
RPC14
Name
(RefSeq) RNApolymerase 14 kDa subunit
  KO
K03020  DNA-directed RNA polymerases I and III subunit RPAC2
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT2G29540 (RPC14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT2G29540 (RPC14)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     AT2G29540 (RPC14)
  RNA polymerase I system
   RNA polymerase I
     AT2G29540 (RPC14)
SSDB
Motif
Pfam: RNA_pol_L_2 RNA_pol_L DUF6277
Other DBs
NCBI-GeneID: 817503
NCBI-ProteinID: NP_001077977
TAIR: AT2G29540
UniProt: A8MRK9
Position
2:12642503..12644330
AA seq 139 aa
MLVYIHVMLLEILIVFNECHIILSLRLMELICWCVDNDDYVNNQYCFQFCSPRVTVAAYT
IPHPSLEQVNIRVQTTGDPAREVFKDACQELMQMNRHVRSVFDKAVAEYKDEQKRKEEAE
EEELKRQRDLFGSMDIENN
NT seq 420 nt   +upstreamnt  +downstreamnt
atgttggtttacattcatgttatgttgttagagattctcattgtattcaatgaatgtcac
attatcttatctttgaggttgatggagttgatatgctggtgtgtagacaatgatgattat
gtcaataaccagtactgttttcaattctgcagtcccagagtaaccgtggctgcatacacc
atcccacatccttcccttgaacaggtcaatatccgggtccagacaacaggtgatccagca
agagaggtttttaaagatgcatgtcaagagctcatgcaaatgaacagacatgtgagaagc
gtttttgataaggctgttgctgagtataaggatgaacaaaagcgtaaggaggaggctgaa
gaagaagagcttaagaggcagagggatctatttgggtccatggacattgaaaacaactga

DBGET integrated database retrieval system