KEGG   Arabidopsis thaliana (thale cress): AT2G40030
Entry
AT2G40030         CDS       T00041                                 
Symbol
NRPD1B
Name
(RefSeq) nuclear RNA polymerase D1B
  KO
K16251  DNA-directed RNA polymerase V subunit 1 [EC:2.7.7.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT2G40030 (NRPD1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT2G40030 (NRPD1B)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     AT2G40030 (NRPD1B)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol IV and V specific subunits
     AT2G40030 (NRPD1B)
SSDB
Motif
Pfam: RNA_pol_Rpb1_2 DUF3223 RNA_pol_Rpb1_3 RNA_pol_Rpb1_5 RNA_pol_Rpb1_1
Other DBs
NCBI-GeneID: 818591
NCBI-ProteinID: NP_181532
TAIR: AT2G40030
UniProt: Q5D869
Position
2:16714460..16723718
AA seq 1976 aa
MEEESTSEILDGEIVGITFALASHHEICIQSISESAINHPSQLTNAFLGLPLEFGKCESC
GATEPDKCEGHFGYIQLPVPIYHPAHVNELKQMLSLLCLKCLKIKKAKGTSGGLADRLLG
VCCEEASQISIKDRASDGASYLELKLPSRSRLQPGCWNFLERYGYRYGSDYTRPLLAREV
KEILRRIPEESRKKLTAKGHIPQEGYILEYLPVPPNCLSVPEASDGFSTMSVDPSRIELK
DVLKKVIAIKSSRSGETNFESHKAEASEMFRVVDTYLQVRGTAKAARNIDMRYGVSKISD
SSSSKAWTEKMRTLFIRKGSGFSSRSVITGDAYRHVNEVGIPIEIAQRITFEERVSVHNR
GYLQKLVDDKLCLSYTQGSTTYSLRDGSKGHTELKPGQVVHRRVMDGDVVFINRPPTTHK
HSLQALRVYVHEDNTVKINPLMCSPLSADFDGDCVHLFYPQSLSAKAEVMELFSVEKQLL
SSHTGQLILQMGSDSLLSLRVMLERVFLDKATAQQLAMYGSLSLPPPALRKSSKSGPAWT
VFQILQLAFPERLSCKGDRFLVDGSDLLKFDFGVDAMGSIINEIVTSIFLEKGPKETLGF
FDSLQPLLMESLFAEGFSLSLEDLSMSRADMDVIHNLIIREISPMVSRLRLSYRDELQLE
NSIHKVKEVAANFMLKSYSIRNLIDIKSNSAITKLVQQTGFLGLQLSDKKKFYTKTLVED
MAIFCKRKYGRISSSGDFGIVKGCFFHGLDPYEEMAHSIAAREVIVRSSRGLAEPGTLFK
NLMAVLRDIVITNDGTVRNTCSNSVIQFKYGVDSERGHQGLFEAGEPVGVLAATAMSNPA
YKAVLDSSPNSNSSWELMKEVLLCKVNFQNTTNDRRVILYLNECHCGKRFCQENAACTVR
NKLNKVSLKDTAVEFLVEYRKQPTISEIFGIDSCLHGHIHLNKTLLQDWNISMQDIHQKC
EDVINSLGQKKKKKATDDFKRTSLSVSECCSFRDPCGSKGSDMPCLTFSYNATDPDLERT
LDVLCNTVYPVLLEIVIKGDSRICSANIIWNSSDMTTWIRNRHASRRGEWVLDVTVEKSA
VKQSGDAWRVVIDSCLSVLHLIDTKRSIPYSVKQVQELLGLSCAFEQAVQRLSASVRMVS
KGVLKEHIILLANNMTCSGTMLGFNSGGYKALTRSLNIKAPFTEATLIAPRKCFEKAAEK
CHTDSLSTVVGSCSWGKRVDVGTGSQFELLWNQKETGLDDKEETDVYSFLQMVISTTNAD
AFVSSPGFDVTEEEMAEWAESPERDSALGEPKFEDSADFQNLHDEGKPSGANWEKSSSWD
NGCSGGSEWGVSKSTGGEANPESNWEKTTNVEKEDAWSSWNTRKDAQESSKSDSGGAWGI
KTKDADADTTPNWETSPAPKDSIVPENNEPTSDVWGHKSVSDKSWDKKNWGTESAPAAWG
STDAAVWGSSDKKNSETESDAAAWGSRDKNNSDVGSGAGVLGPWNKKSSETESNGATWGS
SDKTKSGAAAWNSWDKKNIETDSEPAAWGSQGKKNSETESGPAAWGAWDKKKSETEPGPA
GWGMGDKKNSETELGPAAMGNWDKKKSDTKSGPAAWGSTDAAAWGSSDKNNSETESDAAA
WGSRNKKTSEIESGAGAWGSWGQPSPTAEDKDTNEDDRNPWVSLKETKSREKDDKERSQW
GNPAKKFPSSGGWSNGGGADWKGNRNHTPRPPRSEDNLAPMFTATRQRLDSFTSEEQELL
SDVEPVMRTLRKIMHPSAYPDGDPISDDDKTFVLEKILNFHPQKETKLGSGVDFITVDKH
TIFSDSRCFFVVSTDGAKQDFSYRKSLNNYLMKKYPDRAEEFIDKYFTKPRPSGNRDRNN
QDATPPGEEQSQPPNQSIGNGGDDFQTQTQSQSPSQTRAQSPSQAQAQSPSQTQSQSQSQ
SQSQSQSQSQSQSQSQSQSQSQSQSQSPSQTQTQSPSQTQAQAQSPSSQSPSQTQT
NT seq 5931 nt   +upstreamnt  +downstreamnt
atggaggaagaatctacatcagagattcttgacggagagattgttggaatcacatttgct
cttgctagtcaccatgaaatatgtattcaatcgattagtgaatccgcaattaatcatccc
agtcaactcactaacgcattcttggggttacctcttgaatttggtaaatgtgaatcttgc
ggtgcgacagaaccagataaatgtgaaggtcattttggttatattcagcttccagtgcca
atataccatcctgctcatgttaatgagttgaaacaaatgctgagccttctgtgcttgaaa
tgtctgaagataaagaaggcaaagggcacaagtggtggtctggcggatcgcttgttgggt
gtctgttgtgaggaagcttcgcaaatctcaatcaaagatagagcatcagatggtgcctca
tatctagaactgaagctcccatctaggtcaagactgcagcctggttgctggaatttcctg
gaaagatatggttatcgctatggaagcgattacacgcgtcccctgctggcaagagaggtt
aaggaaattctaagacggatccccgaagaatcaagaaagaaactcacggcaaagggacat
attcctcaagaaggatacatactagagtatcttcctgtcccgcctaactgtttgtcagtg
ccagaggcttctgatggtttcagcaccatgtcagtggatccttccagaattgagctaaag
gacgttctgaagaaagtcatagccataaaaagctctaggtctggcgagacaaactttgag
tcgcataaggctgaagccagtgagatgtttagagtggtggatacctatctccaggtgagg
ggtactgcaaaagcggcaagaaacattgatatgagatacggggtgtctaagatctcggat
agttcatcttcaaaagcttggacagaaaaaatgagaacacttttcatccgtaagggttca
ggtttctcttcccgtagcgtcatcactggagatgcttaccgacatgtgaatgaggtaggg
atcccaatagaaattgcgcagagaatcacatttgaggaaagggttagtgtccacaataga
ggttatctacaaaagttggtagacgacaagttgtgtttgagttatactcaaggttctacg
acctattctttaagggatggatccaaggggcacactgagcttaaacccgggcaggttgtt
catcgcagggtcatggatggggatgttgtgtttatcaacagacccccgacaacacataaa
cattctcttcaagcgcttcgggtgtatgttcatgaagacaacaccgtgaagattaaccct
ctgatgtgtagccccctcagtgctgattttgatggtgattgtgtccatttgttctaccct
cagtctcttagtgctaaggcagaggttatggagctcttctctgtggagaagcaactgctt
agctcacatactggacagctgattttgcagatgggtagtgattctttactgtctttgagg
gtaatgctggagcgggtatttctggacaaggcaactgctcaacagttagctatgtatggc
tctctgtccctgccaccaccagcactaaggaagtccagtaaatctggcccagcttggaca
gttttccagattctacagcttgcctttccagaacgtctgagttgcaaaggagacagattc
ctggttgatggaagtgatttgctgaagtttgatttcggggttgacgcgatggggtccatc
atcaatgaaattgtaacttcaatcttcctggagaagggtccaaaggagacacttggattc
tttgattcgctgcagcctctattgatggaaagtctgtttgctgagggatttagtctaagt
ttggaagacttatccatgtctagggcagacatggatgtaattcacaacctaataatccga
gagatttcacctatggtgtctcgcttgagattatcatatagagatgaattgcagctagag
aacagcatccacaaagtgaaggaagtggctgctaactttatgctgaagtcatattccatt
cggaacttgattgatatcaagagtaactcagcaatcaccaagctggtgcagcagacaggc
ttcttgggtcttcagctttctgacaagaagaagttttacacgaagactctggtagaggac
atggctatcttttgtaagagaaagtatggcaggatttcttcatctggtgattttggaata
gtgaagggctgcttctttcatgggctggatccgtatgaagagatggctcattcaattgca
gctagggaggtaattgttcgctcttcaaggggattagctgagcctggaaccctctttaag
aacctgatggctgttcttcgggatatcgtgattacaaacgatggaactgtaagaaacacc
tgtagtaactcagtcatccagttcaaatatggagttgattctgaacgtggacatcaaggt
ctgtttgaagctggagaacctgttggagtattggcagctactgccatgtcaaatcctgca
tataaggcagtgcttgattcctctccaaatagtaattcatcatgggagctaatgaaggaa
gttctgctctgcaaagtcaatttccaaaacactactaatgatcggcgcgtaatcctttat
ttaaacgaatgccattgtggaaaaaggttttgccaggaaaatgctgcttgcacagtcagg
aacaagctgaataaagttagtcttaaagatactgcagtggaattcctagtcgaatataga
aagcaaccaactatatcagaaatttttggaattgattcatgcctacatggccatattcat
cttaataagacattgctgcaagattggaacatcagtatgcaggatatacatcaaaagtgt
gaggatgtaattaactcactaggacaaaagaaaaagaagaaagctactgatgatttcaag
agaacaagtttgtctgtcagtgagtgctgctctttccgagatccttgtgggagcaaaggt
tcggatatgccttgtttgacgttctcctacaatgccaccgatcccgatctagaacgaact
cttgatgttctttgcaatacagtttacccagttctgctggaaatagtgatcaaaggtgat
tcacggatttgctcagcaaatataatctggaatagttcagacatgacaacgtggatccgg
aatcgtcatgcatcccgccgaggggaatgggttttggatgtcactgttgaaaaatctgct
gtcaagcaaagtggtgatgcatggagggttgtgatagactcatgtctttcagtgcttcat
ctaatagacacaaaacggtcaatcccttattctgtaaaacaagtgcaagaattgcttggg
ttatcctgtgcttttgagcaagcagtacagcgtctatcagcttcagtgagaatggtctcc
aagggagttttgaaagaacacatcattctcctagcaaacaacatgacttgttcagggact
atgttgggtttcaattctggaggttacaaagctttgacccgatccttaaacatcaaggct
ccattcacagaagcaactctgattgcaccaagaaaatgttttgagaaagcggctgagaaa
tgtcatacagattcactatcaacagtcgttgggtcttgttcttggggaaaacgcgtggat
gttggtacaggctcacagtttgagctcctatggaaccaaaaagagactggtctagatgat
aaagaagaaacagatgtgtacagcttccttcaaatggtcatatccacgacaaacgcagat
gcatttgtttcttcccctggttttgatgttacagaggaagaaatggctgaatgggctgaa
tcgcccgagcgagactctgctcttggagagcccaagtttgaggacagtgccgacttccaa
aatttacatgacgaaggcaagccatcaggagccaactgggagaaaagctcttcgtgggac
aatggttgcagtggtggttcagagtggggagtctcaaaaagtacaggtggtgaggcaaac
ccggagtctaattgggaaaagactacaaatgttgagaaggaagatgcttggtctagttgg
aacactagaaaagatgctcaagaatcttccaagtcagattcagggggtgcttggggtata
aagacaaaggatgctgatgcagatacaacaccaaactgggaaacaagtccagctccgaag
gattccattgtcccagaaaataatgagccgacttctgacgtttggggacacaaatctgtt
tcagacaaatcgtgggacaaaaagaactggggaactgaatcagctcctgctgcatggggt
tctacagatgctgctgtttggggttctagtgataaaaagaactcggaaacagaatcagat
gctgctgcttggggttccagggacaaaaataattctgacgttgggtcaggtgctggtgtt
ttaggtccctggaacaagaagagctcggaaactgagtcaaatggtgctacttggggttct
agtgacaaaaccaaatcaggtgctgctgcatggaattcttgggacaaaaagaacatagaa
actgactcagaacctgctgcttggggttctcagggaaaaaagaattctgaaactgagtca
ggtcctgctgcttggggtgcttgggacaaaaagaaatcggaaactgaaccaggtcctgct
ggttggggtatgggggacaaaaagaattctgaaactgaattaggccctgctgctatgggt
aattgggacaaaaagaaatcggatacgaaatcaggtccagctgcttggggatctacagat
gctgctgcttggggttctagtgacaaaaacaactcggaaactgaatcagatgctgctgct
tggggttctaggaacaaaaagacttctgaaattgaatcaggtgctggcgcttggggttcg
tggggacagccaagtcccactgcagaagacaaggataccaatgaggatgatagaaatccg
tgggtttccttgaaggagaccaaaagtagagagaaggatgataaagagagaagccagtgg
ggaaatccagccaagaaatttccatctagtggtggctggtccaatggtggtggtgcagac
tggaaaggaaataggaaccatactcctaggccacctagatctgaggataatttggctccc
atgtttacagcaacgagacagcgcttggactcattcacctctgaggagcaagagctgctc
tcagatgttgagccagtcatgaggactctcaggaaaattatgcatccgtctgcgtaccct
gatggagacccaatttctgatgatgacaagacgtttgtcctggagaagattttgaacttc
catccccaaaaagagacaaagcttggttctggcgttgacttcatcacggttgataagcac
accatcttctcagacagcaggtgcttctttgttgtctcaactgatggggccaaacaggac
ttttcataccgaaaatccctcaacaactatttgatgaagaaataccctgaccgtgctgaa
gaattcattgacaagtactttacgaaacctcggcctagcggaaacagagacaggaacaac
caagatgccacaccacctggggaagaacagtctcagcctccgaatcagtctataggtaat
ggaggtgacgactttcagacacagactcagtctcagtctccatctcagactcgggctcag
tctccatctcaggctcaggctcagtctccatctcagacgcagtctcagtctcagtctcag
tctcagtctcagtctcagtctcagtctcagtctcagtctcagtctcagtctcagtctcag
tctcagtctcagtctcagtctccatcccagactcagactcagtctccgtctcagactcag
gctcaggctcagtctccatcatctcagtctccgtcccagacgcagacataa

DBGET integrated database retrieval system