KEGG   Arabidopsis thaliana (thale cress): AT2G41340
Entry
AT2G41340         CDS       T00041                                 
Symbol
RPB5D
Name
(RefSeq) RNA polymerase II fifth largest subunit, D
  KO
K03013  DNA-directed RNA polymerases I, II, and III subunit RPABC1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT2G41340 (RPB5D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT2G41340 (RPB5D)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT2G41340 (RPB5D)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     AT2G41340 (RPB5D)
  RNA polymerase III system
   RNA polymerase III
     AT2G41340 (RPB5D)
  RNA polymerase I system
   RNA polymerase I
     AT2G41340 (RPB5D)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      AT2G41340 (RPB5D)
SSDB
Motif
Pfam: RNA_pol_Rpb5_C RNA_pol_Rpb5_N
Other DBs
NCBI-GeneID: 818732
NCBI-ProteinID: NP_181665
TAIR: AT2G41340
UniProt: Q9ZVB9 A0A178VXX0
Position
2:17228733..17231082
AA seq 218 aa
MEGKGKEIVVGHSISKSSVECHKYYLARRTTMEMLRDRGYDVSDEDINLSLQQFRALYGE
HPDVDLLRISAKHRFDSSKKISVVFCGTGIVKVNAMRVIAADVLSRENITGLILVLQSHI
TNQALKAVELFSFKVELFEITDLLVNVSKHVLRPKHQVLNDKEKESLLKKFSIEEKQLPR
LSSKDPIVRYYGLETGQVMKVTYKDELSESHVTYRCVS
NT seq 657 nt   +upstreamnt  +downstreamnt
atggaggggaaagggaaagagatagtggttggacattccattagtaaatcaagtgtagag
tgtcacaaatattacctggcacgtcgaaccaccatggagatgctccgagacagaggatac
gatgtctccgacgaagatattaacctctccctccagcaatttcgagcgctctatggggaa
catcctgacgtagatctacttcgtatctcagccaaacatcgctttgattcttcgaaaaag
atctcggtagtgttttgtggaactggtatagttaaagtcaatgcgatgcgcgtcattgca
gcagatgtgcttagccgagaaaatataaccggactgatactggttttgcaaagtcatata
acgaaccaagctcttaaagccgttgaacttttctcctttaaggtcgagttattcgagatt
accgatttgttggttaacgtaagcaaacatgtcttgaggccaaaacatcaggttctgaac
gataaagagaaggaatcacttctcaagaagttcagtattgaggagaaacaacttcctcgg
ttatcgagcaaagacccgattgtgcgatactatggactagagacagggcaagtcatgaag
gtcacatacaaagacgagctcagtgagtcgcatgttacataccgatgcgtttcttaa

KEGG   Arabidopsis thaliana (thale cress): AT3G22320
Entry
AT3G22320         CDS       T00041                                 
Symbol
NRPB5
Name
(RefSeq) Eukaryotic rpb5 RNA polymerase subunit family protein
  KO
K03013  DNA-directed RNA polymerases I, II, and III subunit RPABC1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT3G22320 (NRPB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT3G22320 (NRPB5)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT3G22320 (NRPB5)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     AT3G22320 (NRPB5)
  RNA polymerase III system
   RNA polymerase III
     AT3G22320 (NRPB5)
  RNA polymerase I system
   RNA polymerase I
     AT3G22320 (NRPB5)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      AT3G22320 (NRPB5)
SSDB
Motif
Pfam: RNA_pol_Rpb5_C RNA_pol_Rpb5_N DUF3557
Other DBs
NCBI-GeneID: 821801
NCBI-ProteinID: NP_188871
TAIR: AT3G22320
UniProt: O81098 A0A178VI93
Structure
Position
3:complement(7890803..7892349)
AA seq 205 aa
MLTEEELKRLYRIQKTLMQMLRDRGYFIADSELTMTKQQFIRKHGDNMKREDLVTLKAKR
NDNSDQLYIFFPDEAKVGVKTMKMYTNRMKSENVFRAILVVQQNLTPFARTCISEISSKF
HLEVFQEAEMLVNIKEHVLVPEHQVLTTEEKKTLLERYTVKETQLPRIQVTDPIARYFGL
KRGQVVKIIRPSETAGRYVTYRYVV
NT seq 618 nt   +upstreamnt  +downstreamnt
atgttgacggaagaggagctcaaaagattgtacagaatccagaagacgttgatgcagatg
ttaagggatcgtggatattttatcgcggattctgaacttacgatgactaaacaacagttt
attaggaaacatggtgataacatgaaaagagaggatcttgttactcttaaggctaagcga
aatgataatagtgatcagctctatatattcttccctgatgaggcgaaagttggtgtgaag
acgatgaaaatgtacacgaacaggatgaaatcagagaatgtgttcagagctattttggtt
gtgcaacagaacttgaccccgtttgctcgaacttgcattagtgagatctcttctaagttt
catctggaagttttccaggaggcggaaatgctagtgaacattaaagaacatgttcttgtt
cctgagcatcaagttcttaccactgaagagaagaaaactttactggagagatacacagtg
aaggagacacagcttccaaggatccaagtgactgatccaatcgcaagatactttggacta
aaacgtgggcaagtcgtgaagatcattcgtccgagtgaaacggctggtcgttatgttacc
tatcgttatgttgtataa

KEGG   Arabidopsis thaliana (thale cress): AT3G54490
Entry
AT3G54490         CDS       T00041                                 
Symbol
RPB5E
Name
(RefSeq) RNA polymerase II fifth largest subunit, E
  KO
K03013  DNA-directed RNA polymerases I, II, and III subunit RPABC1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT3G54490 (RPB5E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT3G54490 (RPB5E)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT3G54490 (RPB5E)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     AT3G54490 (RPB5E)
  RNA polymerase III system
   RNA polymerase III
     AT3G54490 (RPB5E)
  RNA polymerase I system
   RNA polymerase I
     AT3G54490 (RPB5E)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      AT3G54490 (RPB5E)
SSDB
Motif
Pfam: RNA_pol_Rpb5_C RNA_pol_Rpb5_N DUF1473
Other DBs
NCBI-GeneID: 824614
NCBI-ProteinID: NP_191013
TAIR: AT3G54490
UniProt: Q9M1H8 A0A5S9XMG6
Position
3:20173605..20175462
AA seq 233 aa
MEETMAEEGCCENVESTFDDGTNCISKTEDTGGIESKRFYLARTTAFEMLRDRGYEVNEA
ELSLTLSEFRSVFGEKPELERLRICVPLRSDPKKKILVVFMGTEPITVKSVRALHIQISN
NVGLHAMILVLQSKMNHFAQKALTTFPFTVETFPIEDLLVNITKHIQQPKIEILNKEEKE
QLLRKHALEDKQLPYLQEKDSFVRYYGLKKKQVVKITYSKEPVGDFVTYRCII
NT seq 702 nt   +upstreamnt  +downstreamnt
atggaggagacaatggccgaagaagggtgctgtgaaaatgttgagtcgacgtttgacgac
ggtaccaactgtatttcgaagactgaggacaccggaggaatcgaaagcaagaggttttac
ttggctcgcacgacagcttttgagatgcttcgcgatagaggctacgaagttaatgaagct
gagctctctctcactctttctgagtttcgttctgtttttggtgagaagcctgagcttgaa
cgcctccgtatctgcgttcctcttcgctcagatcccaagaaaaagatccttgttgtgttc
atgggaactgaaccaatcaccgtgaagtcagttcgtgctcttcatattcagatttccaac
aatgtaggcttgcatgctatgattctggttttacagagcaaaatgaaccactttgcccag
aaggcattgactaccttcccttttacagttgaaactttcccgattgaagatttgttggtc
aacatcacaaagcacattcagcagccaaagattgagattttaaacaaagaggagaaagaa
caactgctgaggaagcatgcacttgaggacaaacagcttccttatttgcaggagaaggac
agctttgtgaggtactatgggttaaagaaaaaacaggtggtgaagattacatacagtaaa
gagcctgttggggattttgtgacataccgatgcatcatctga

KEGG   Arabidopsis thaliana (thale cress): AT3G57080
Entry
AT3G57080         CDS       T00041                                 
Symbol
NRPE5
Name
(RefSeq) Eukaryotic rpb5 RNA polymerase subunit family protein
  KO
K03013  DNA-directed RNA polymerases I, II, and III subunit RPABC1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT3G57080 (NRPE5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT3G57080 (NRPE5)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT3G57080 (NRPE5)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     AT3G57080 (NRPE5)
  RNA polymerase III system
   RNA polymerase III
     AT3G57080 (NRPE5)
  RNA polymerase I system
   RNA polymerase I
     AT3G57080 (NRPE5)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      AT3G57080 (NRPE5)
SSDB
Motif
Pfam: RNA_pol_Rpb5_C RNA_pol_Rpb5_N
Other DBs
NCBI-GeneID: 824875
NCBI-ProteinID: NP_191267
TAIR: AT3G57080
UniProt: Q9M1J2 A0A5S9XLJ5
Position
3:21125725..21128075
AA seq 222 aa
MEVKGKETASVLCLSKYVDLSSEESHRYYLARRNGLQMLRDRGYEVSDEDINLSLHDFRT
VYGERPDVDRLRISALHRSDSTKKVKIVFFGTSMVKVNAIRSVVADILSQETITGLILVL
QNHVTNQALKAIELFSFKVEIFQITDLLVNITKHSLKPQHQVLNDEEKTTLLKKFSIEEK
QLPRISKKDAIVRYYGLEKGQVVKVNYRGELTESHVAFRCVW
NT seq 669 nt   +upstreamnt  +downstreamnt
atggaagtgaaagggaaagagacagcttcggttctgtgtctgagcaaatacgtggatcta
tcgagtgaagagagtcatagatactatcttgcgcggcgaaatggcttgcagatgctccga
gacagaggctacgaagtctccgacgaagatatcaatctctcccttcacgattttcgaact
gtttacggtgaacgtcccgatgttgatcgtcttcgcatctccgctctgcatcgctccgat
tctaccaaaaaggtaaaaattgtcttttttggtactagtatggttaaagtcaacgcaatc
cgcagtgtagtagcggatatacttagccaagaaaccataactgggctgatattggttctg
caaaaccatgtaaccaatcaagccttgaaagccattgaacttttttctttcaaggtcgag
atattccagataacggatctgctagtcaacataaccaaacattcactgaagccacaacat
caggtgttgaatgatgaagagaagacaacacttctcaagaagttcagcattgaggaaaaa
cagcttcctcggatttcaaagaaagatgctatcgtccggtactacggattagagaaaggg
caagttgtgaaggtgaattacagaggcgaactcacggaatcgcatgttgccttccgatgt
gtgtggtga

KEGG   Arabidopsis thaliana (thale cress): AT5G57980
Entry
AT5G57980         CDS       T00041                                 
Symbol
RPB5C
Name
(RefSeq) RNA polymerase II fifth largest subunit, C
  KO
K03013  DNA-directed RNA polymerases I, II, and III subunit RPABC1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT5G57980 (RPB5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT5G57980 (RPB5C)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT5G57980 (RPB5C)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     AT5G57980 (RPB5C)
  RNA polymerase III system
   RNA polymerase III
     AT5G57980 (RPB5C)
  RNA polymerase I system
   RNA polymerase I
     AT5G57980 (RPB5C)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      AT5G57980 (RPB5C)
SSDB
Motif
Pfam: RNA_pol_Rpb5_N RNA_pol_Rpb5_C AAA_3
Other DBs
NCBI-GeneID: 835909
NCBI-ProteinID: NP_200606
TAIR: AT5G57980
UniProt: Q9FJL8 A0A178UMU7
Position
5:complement(23468959..23469856)
AA seq 210 aa
MSDMDDEITRIFKVRRTVLQMLRDRGYTIEESDLNLKREEFVQRFCKTMNKVNKEALFVS
ANKGPNPADKIYVFYPEGPKVGVPVIKKEVAIKMRDDKVHRGIVVVPMAITAPARMAVSE
LNKMLTIEVFEEAELVTNITEHKLVNKYYVLDDQAKKKLLNTYTVQDTQLPRILVTDPLA
RYYGLKRGQVVKIRRSDATSLDYYTYRFAV
NT seq 633 nt   +upstreamnt  +downstreamnt
atgtcggacatggatgatgaaatcacgaggattttcaaggtgcgtcgcacggtgcttcag
atgctgagggatcgaggttacactatagaagaatcggacttgaacttgaaaagagaagag
tttgttcagaggttttgtaaaactatgaacaaagtgaacaaggaagctcttttcgtctca
gccaataaggggccaaatccagccgacaagatttacgtgttctacccggaagggcctaag
gtgggagtcccagtgattaagaaggaagtggcaataaagatgcgagacgataaagttcat
cgagggatcgtagttgttccaatggccataactgctcccgctagaatggccgtatcagaa
ctcaacaagatgctaacgattgaagtctttgaggaagctgaattggtgaccaacatcact
gagcataaactcgtcaacaagtactatgttctcgacgatcaagcaaagaagaaattactc
aacacgtacacggtgcaagacacacagttgcctcgcatccttgtcactgatcctcttgcc
agatactatggactcaagcgaggacaagttgtcaagatcagacgaagcgatgctacttca
ttggactattatacctaccgatttgctgtttga

DBGET integrated database retrieval system