KEGG   Arabidopsis thaliana (thale cress): AT2G46110
Entry
AT2G46110         CDS       T00041                                 
Symbol
KPHMT1
Name
(RefSeq) ketopantoate hydroxymethyltransferase 1
  KO
K00606  3-methyl-2-oxobutanoate hydroxymethyltransferase [EC:2.1.2.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00770  Pantothenate and CoA biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT2G46110 (KPHMT1)
Enzymes [BR:ath01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.11  3-methyl-2-oxobutanoate hydroxymethyltransferase
     AT2G46110 (KPHMT1)
SSDB
Motif
Pfam: Pantoate_transf PEP_mutase
Other DBs
NCBI-GeneID: 819219
NCBI-ProteinID: NP_182135
TAIR: AT2G46110
UniProt: O82357 A0A7G2EHT3
Position
2:complement(18954570..18956582)
AA seq 347 aa
MASSLTRNCSRFSKAISVRFMSNLPENTVYGGPKPQNPNQRVTLTHLRQKHRRGEPITVV
TAYDYPSAVHLDTAGIDVCLVGDSASMVVHGHDTTLPISLDEMLVHCRAVARGAKRPLLV
GDLPFGTYESSSSQAVDTAVRVLKEGGMDAIKLEGGSASRITAAKAIVEAGIAVIGHVGL
TPQAISVLGGFRPQGRNIASAVKVVETAMALQEAGCFSVVLECVPPPVAAAATSALKIPT
IGIGAGPFCSGQVLVYHDLLGMMQHPHHAKVTPKFCKQYANVGEVINKALMEYKEEVSKK
VFPGPSHSPYKITASELDGFLTELQKLGFDKAASAAALAAENMEPSK
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggcgtcctcactcactaggaattgctctcgcttctcaaaagccatctctgtccgtttc
atgagtaacctaccggaaaacaccgtctacggaggaccaaagccacaaaacccaaaccaa
agagtgacgctaacgcatctcagacaaaaacaccggagaggagaaccgatcaccgtcgta
actgcctacgattacccatccgccgttcatttagacacagctggtatcgatgtttgtctt
gtcggtgactcagcttccatggttgttcatggtcacgacacaacacttcctatctcctta
gacgagatgcttgttcattgtcgtgccgttgctcgaggcgctaaacgacctctcctagtt
ggtgacttgccatttggtacctacgagtcaagctctagtcaggcggttgatactgcggtt
agggttttgaaggaaggaggaatggatgcgattaagctcgaaggaggatcagcttctagg
atcactgctgcaaaagctatagttgaagcaggaattgcggttattggtcatgtgggtcta
acccctcaggcgattagcgttcttggtggtttcagaccccaaggcagaaacatagctagt
gctgttaaagttgttgagactgcaatggctttacaagaagctggatgtttttcggttgtt
ttggaatgcgttccacctcctgtagctgctgctgcaacttctgccctcaagataccaacc
attggcattggggctggacctttctgcagtggacaggtgctagtttaccatgatcttctt
ggtatgatgcaacatccacatcatgccaaggttactccaaagttttgcaagcagtacgct
aatgtcggagaagtgattaacaaagccctaatggaatacaaagaagaagtctctaaaaaa
gtgtttccaggtccttctcacagtccttacaagatcacagcaagtgagctcgatgggttc
ttaaccgagttgcagaagcttggttttgacaaggctgcttctgcagcagctttagcagct
gagaacatggagccttcaaagtga

KEGG   Arabidopsis thaliana (thale cress): AT3G61530
Entry
AT3G61530         CDS       T00041                                 
Symbol
PANB2
Name
(RefSeq) Phosphoenolpyruvate carboxylase family protein
  KO
K00606  3-methyl-2-oxobutanoate hydroxymethyltransferase [EC:2.1.2.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00770  Pantothenate and CoA biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT3G61530 (PANB2)
Enzymes [BR:ath01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.11  3-methyl-2-oxobutanoate hydroxymethyltransferase
     AT3G61530 (PANB2)
SSDB
Motif
Pfam: Pantoate_transf PEP_mutase
Other DBs
NCBI-GeneID: 825326
NCBI-ProteinID: NP_191712
TAIR: AT3G61530
UniProt: Q9M315 A0A654FJS9
Position
3:complement(22771405..22773790)
AA seq 354 aa
MAASLVRSCCSRASRAITTVRFMSNVPEDTVYGGPKPQNSNQRVTLTQLRQKHRKGEPIT
MVTAYDYPSAVHIDTAGIDVCLVGDSAAMVVHGYDTTLPISLEEMLVHCRAVARGAKRPL
LVGDLPFGTYESSTNQAVDTAVRVLKEGGMDAIKLEGGSPSRITAAKSIVEAGIAVMGHV
GLTPQAISVLGGFRPQGKNIASAVKVVETAMALQEAGCFSVVLECVPPPVAAAATSALNI
PTIGIGAGPFCSGQVLVYHDLLGMMQHPHHAKVTPKFCKQYAQVGEVINKALLEYKEEVS
KHLFPGPSHSPYKISSSDLDGFLSELQKLGLDKAASDAAASAEKMDHSDSPSSQ
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggctgcttcgctcgtcaggagttgttgctctcgtgcttcgagagccatcaccaccgtc
cggtttatgagcaacgtaccggaggacacggtttacggaggaccgaaaccgcagaactcg
aatcagagagtgactttgacgcaattgagacagaagcatcggaaaggtgagccgataact
atggtcaccgcctacgattacccttctgccgttcacatcgatacagctggaatcgatgtt
tgtctcgtcggagattcagctgccatggttgtccatggctatgacaccactcttcctatc
tccttagaggagatgcttgttcactgtcgcgccgttgctcgcggagccaaaagaccactt
cttgtcggcgatttgccgtttggtacttatgaatctagcaccaatcaggcggttgatact
gcagttagggtgttgaaagaaggaggaatggatgctattaaacttgaaggaggatcacct
tcaaggatcactgctgcaaaatccattgtggaagcagggattgccgttatgggacatgtt
gggttgactcctcaagctatcagtgttcttggtggtttcaggccacagggcaaaaacatt
gctagtgctgttaaggttgtggaaactgctatggctttgcaagaagctggatgtttttcg
gttgttttagaatgtgttccacctcctgtggctgctgctgcaacctctgctcttaatatt
ccaaccattggcataggagctggccctttctgcagtggtcaggttttagtctaccatgat
cttctgggaatgatgcagcatccacatcacgctaaggttactccaaagttttgcaaacag
tacgctcaagtaggagaagtgatcaacaaagccctcttggagtataaggaagaagtatcc
aaacacttgtttccaggtccttctcacagcccttacaagatctcctcaagcgacctggac
ggattcttaagcgagttacagaaattgggattagataaagctgcttctgatgcagcagca
tcagctgaaaagatggatcattcagattcaccatcttctcagtga

DBGET integrated database retrieval system