KEGG   Arabidopsis thaliana (thale cress): AT3G11470
Entry
AT3G11470         CDS       T00041                                 
Name
(RefSeq) 4'-phosphopantetheinyl transferase superfamily
  KO
K06133  4'-phosphopantetheinyl transferase [EC:2.7.8.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00770  Pantothenate and CoA biosynthesis
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT3G11470
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.-
     AT3G11470
SSDB
Motif
Pfam: ACPS
Other DBs
NCBI-GeneID: 820320
NCBI-ProteinID: NP_001030671
TAIR: AT3G11470
UniProt: F4J6B2
Position
3:complement(3610147..3612639)
AA seq 231 aa
MSLRRMLCLLEPWFGPPLLDTNNEVDPKALMFKKNMYGKPEVDWQNYTNCNNPPLHFNIS
HTDSLIACGVTVHVPVGIDVEDKERKIKHDILAFAERFYSADEVKFLSTLPDPEVQRKEF
IKLWTLKEAYVKALGKGFSAAPFNTFTIQSKVGTKGEYNLCKMTEMTASSLEETNKCDGE
WKFSLLELDDSHYAAICIEDDEASGGAPMRVIVRKTIPFVEDELISESKLL
NT seq 696 nt   +upstreamnt  +downstreamnt
atgagcttaagaagaatgctttgcttgctcgaaccttggttcggaccaccattgctagat
acaaacaatgaagtcgatcctaaggccttgatgttcaagaagaatatgtatgggaagcct
gaggtagattggcagaattatacgaactgtaataatccaccattgcatttcaacatttct
cacacagattcattaattgcctgtggggtgactgtacacgttccggttggtatcgatgtt
gaagacaaggaaaggaagattaaacatgatatcttagcatttgcagaaagattttactct
gctgatgaagtcaagtttttgtcaactttaccggaccctgaagttcagagaaaggaattt
attaagttatggaccctaaaggaggcatatgtgaaagcattaggaaaaggcttttctgct
gcaccttttaataccttcacaatccagtccaaggttggaacaaaaggagaatacaatctt
tgcaagatgactgaaatgactgcaagttcgctggaggagacaaacaaatgcgatggagaa
tggaagttttcccttttggagttggatgattctcattatgctgcaatctgtattgaagat
gatgaagctagtggaggagctcctatgagggtgattgtccgaaaaaccatcccgtttgta
gaagatgaacttatatctgaaagcaaacttctttag

DBGET integrated database retrieval system